DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and Ppp4c

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001347393.1 Gene:Ppp4c / 56420 MGIID:1891763 Length:307 Species:Mus musculus


Alignment Length:319 Identity:100/319 - (31%)
Similarity:163/319 - (51%) Gaps:26/319 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 DLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVL 255
            ||...:.:.:|...:....|..:..:|.:.|.:..|:.    .|...||||||:||:..||..:.
Mouse     6 DLDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQ----RVDSPVTVCGDIHGQFYDLKELF 66

  Fly   256 HKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREV 320
            ...|....:| |:|.|||||||...:|..||||:|.:.:|:.:.|.|||||...:...|||..|.
Mouse    67 RVGGDVPETN-YLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDEC 130

  Fly   321 ESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDS-TSLDLIKSIDRGKYVSILRPPL 384
            ..||  ....:..:..|::.:|.|.::::.::..||||.|.| .:||.|::|||.:.|.      
Mouse   131 LRKY--GSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVP------ 187

  Fly   385 TDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKP 449
            .||         .:.|::||||:.|.|...:. ||||..||.||...|...:.:..:.|:|:...
Mouse   188 HDG---------PMCDLLWSDPEDTTGWGVSP-RGAGYLFGSDVVAQFNAANDIDMICRAHQLVM 242

  Fly   450 NGHEFMHDNKIITIFSASNY-YAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQ 507
            .|:::..:..::|::||.|| |..| |..|.:.|:..|...|:.:.:|..:|:.:..|:
Mouse   243 EGYKWHFNETVLTVWSAPNYCYRCG-NVAAILELDEHLQKDFIIFEAAPQETRGIPSKK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 97/304 (32%)
EFh 616..681 CDD:238008
Ppp4cNP_001347393.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 97/307 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.