DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PPP6C

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001116827.1 Gene:PPP6C / 5537 HGNCID:9323 Length:342 Species:Homo sapiens


Alignment Length:277 Identity:96/277 - (34%)
Similarity:143/277 - (51%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 YVA-LILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGD 272
            ||. |:|.|:        |:.||||    .||||||:||:..||..:....|....:| |:|.||
Human    67 YVCDLLLEES--------NVQPVST----PVTVCGDIHGQFYDLCELFRTGGQVPDTN-YIFMGD 118

  Fly   273 FVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDE 337
            |||||...||....||:|...:|:.:.|.|||||...:...|||..|.::||  .:.....:..:
Human   119 FVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTKY--GNANAWRYCTK 181

  Fly   338 VYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQI--- 398
            |:..|.:.::::.::|.||||.| |..:||.|::|:|.                     |:|   
Human   182 VFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERN---------------------QEIPHK 225

  Fly   399 ---FDIMWSDPQ--ATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDN 458
               .|::||||:  .|....|   ||||..||..||:.|:..:.|..:.|:|:....|::||.|.
Human   226 GAFCDLVWSDPEDVDTWAISP---RGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDE 287

  Fly   459 KIITIFSASNY-YAIGS 474
            |::|::||.|| |..|:
Human   288 KLVTVWSAPNYCYRCGN 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 96/277 (35%)
EFh 616..681 CDD:238008
PPP6CNP_001116827.1 MPP_PP2A_PP4_PP6 5..326 CDD:277360 96/277 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.