DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PPP2CA

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_002706.1 Gene:PPP2CA / 5515 HGNCID:9299 Length:309 Species:Homo sapiens


Alignment Length:294 Identity:93/294 - (31%)
Similarity:155/294 - (52%) Gaps:30/294 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 RLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYV 268
            :|....|..:..:|.:.|.:..|:..|..    .||||||:||:..||:.:....|....:| |:
Human    22 QLSESQVKSLCEKAKEILTKESNVQEVRC----PVTVCGDVHGQFHDLMELFRIGGKSPDTN-YL 81

  Fly   269 FNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILA 333
            |.||:||||...:|.:.||::|.:.:...:.:.|||||...:...|||..|...||  .:..:..
Human    82 FMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKY--GNANVWK 144

  Fly   334 FIDEVYRWLPLGSVLNSRVLIVHGGFSDS-TSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQ 397
            :..:::.:|||.::::.::..:|||.|.| .:||.|:::||.:.|....|               
Human   145 YFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGP--------------- 194

  Fly   398 IFDIMWSDP--QATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKI 460
            :.|::||||  :...|..|   ||||..||.|:::.|...:.|:.|.|:|:....|:.:.||..:
Human   195 MCDLLWSDPDDRGGWGISP---RGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNV 256

  Fly   461 ITIFSASNY-YAIGSNKGAYIRLNNQLMPHFVQY 493
            :|||||.|| |..| |:.|.:.|::.|...|:|:
Human   257 VTIFSAPNYCYRCG-NQAAIMELDDTLKYSFLQF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 93/294 (32%)
EFh 616..681 CDD:238008
PPP2CANP_002706.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 93/294 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.