DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PPP1CC

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens


Alignment Length:324 Identity:105/324 - (32%)
Similarity:163/324 - (50%) Gaps:35/324 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 KNHIDLLIDVFRKKRGNR------LHPKYV-ALILREAAKSLKQLPNISPVSTAVSQQVTVCGDL 244
            |.:||.:|....:.||::      |....: .|.|:.....|.|     |:...:...:.:|||:
Human     6 KLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQ-----PILLELEAPLKICGDI 65

  Fly   245 HGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSV 309
            ||:..|||.:....|.|..|| |:|.||:|||||:.||.:.|||:..:.:|...||.|||||.:.
Human    66 HGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECAS 129

  Fly   310 MNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDR 373
            :|..|||..|.:.:|  |.|....|.| .:..||:.::::.::...|||.| |..|::.|:.|.|
Human   130 INRIYGFYDECKRRY--NIKLWKTFTD-CFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMR 191

  Fly   374 GKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDP-QATMGCVPNTLRGAGVWFGPDVTDNFLQRHR 437
                           |.|..:...:.|::|||| :..:|...|. ||....||.:|...||.:|.
Human   192 ---------------PTDVPDQGLLCDLLWSDPDKDVLGWGEND-RGVSFTFGAEVVAKFLHKHD 240

  Fly   438 LSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTK 501
            |..:.|:|:...:|:||....:::|:|||.||.....|.||.:.::..||..| |.:..|.:.|
Human   241 LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSF-QILKPAEKKK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 103/315 (33%)
EFh 616..681 CDD:238008
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 105/324 (32%)
MPP_PP1_PPKL 8..298 CDD:277359 102/315 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.