DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PPP1CA

DIOPT Version :10

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001008709.1 Gene:PPP1CA / 5499 HGNCID:9281 Length:341 Species:Homo sapiens


Alignment Length:274 Identity:92/274 - (33%)
Similarity:142/274 - (51%) Gaps:21/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 PVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLA 293
            |:...:...:.:|||:||:..|||.:....|.|..|| |:|.||:|||||:.||.:.|||:..:.
Human    61 PILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIK 124

  Fly   294 FPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGG 358
            :|...||.|||||.:.:|..|||..|.:.:|  |.|....|.| .:..||:.::::.::...|||
Human   125 YPENFFLLRGNHECASINRIYGFYDECKRRY--NIKLWKTFTD-CFNCLPIAAIVDEKIFCCHGG 186

  Fly   359 FS-DSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGV 422
            .| |..|::.|:.|.|               |.|..:...:.|::||||...:.......||...
Human   187 LSPDLQSMEQIRRIMR---------------PTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSF 236

  Fly   423 WFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLM 487
            .||.:|...||.:|.|..:.|:|:...:|:||....:::|:|||.||.....|.||.:.::..||
Human   237 TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLM 301

  Fly   488 PHFVQYISAASQTK 501
            ..| |.:..|.:.|
Human   302 CSF-QILKPADKNK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 90/265 (34%)
FRQ1 527..681 CDD:444056
EFh 616..681 CDD:238008
PPP1CANP_001008709.1 MPP_PP1_PPKL 8..309 CDD:277359 90/267 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.