DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PPP1CA

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001008709.1 Gene:PPP1CA / 5499 HGNCID:9281 Length:341 Species:Homo sapiens


Alignment Length:274 Identity:92/274 - (33%)
Similarity:142/274 - (51%) Gaps:21/274 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 PVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLA 293
            |:...:...:.:|||:||:..|||.:....|.|..|| |:|.||:|||||:.||.:.|||:..:.
Human    61 PILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIK 124

  Fly   294 FPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGG 358
            :|...||.|||||.:.:|..|||..|.:.:|  |.|....|.| .:..||:.::::.::...|||
Human   125 YPENFFLLRGNHECASINRIYGFYDECKRRY--NIKLWKTFTD-CFNCLPIAAIVDEKIFCCHGG 186

  Fly   359 FS-DSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGV 422
            .| |..|::.|:.|.|               |.|..:...:.|::||||...:.......||...
Human   187 LSPDLQSMEQIRRIMR---------------PTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSF 236

  Fly   423 WFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLM 487
            .||.:|...||.:|.|..:.|:|:...:|:||....:::|:|||.||.....|.||.:.::..||
Human   237 TFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLM 301

  Fly   488 PHFVQYISAASQTK 501
            ..| |.:..|.:.|
Human   302 CSF-QILKPADKNK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 90/265 (34%)
EFh 616..681 CDD:238008
PPP1CANP_001008709.1 PTZ00480 6..319 CDD:185658 92/274 (34%)
MPP_PP1_PPKL 8..309 CDD:277359 90/267 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.