DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and mts

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster


Alignment Length:295 Identity:95/295 - (32%)
Similarity:156/295 - (52%) Gaps:30/295 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 NRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPY 267
            |:|....|..:..:|.:.|.:..|:..|..    .||||||:||:..||:.:....|....:| |
  Fly    21 NQLTETQVRTLCDKAKEILSKESNVQEVKC----PVTVCGDVHGQFHDLMELFRIGGKSPDTN-Y 80

  Fly   268 VFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRIL 332
            :|.||:||||...:|.:.||::|.:.:...:.:.|||||...:...|||..|...||  .:..:.
  Fly    81 LFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKY--GNANVW 143

  Fly   333 AFIDEVYRWLPLGSVLNSRVLIVHGGFSDS-TSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQ 396
            .:..:::.:|||.::::.::..:|||.|.| .|||.|:::||.:.|....|              
  Fly   144 KYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGP-------------- 194

  Fly   397 QIFDIMWSDP--QATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 459
             :.|::||||  :...|..|   ||||..||.|:::.|...:.|:.|.|:|:....|:.:.||..
  Fly   195 -MCDLLWSDPDDRGGWGISP---RGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCHDRN 255

  Fly   460 IITIFSASNY-YAIGSNKGAYIRLNNQLMPHFVQY 493
            ::|||||.|| |..| |:.|.:.|::.|...|:|:
  Fly   256 VVTIFSAPNYCYRCG-NQAALMELDDSLKFSFLQF 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 95/295 (32%)
EFh 616..681 CDD:238008
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 95/295 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.