DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and Pp4-19C

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001285489.1 Gene:Pp4-19C / 45031 FlyBaseID:FBgn0023177 Length:307 Species:Drosophila melanogaster


Alignment Length:324 Identity:104/324 - (32%)
Similarity:162/324 - (50%) Gaps:30/324 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 NHIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLL 252
            ::.||...:.:.||...:....|..:..:|.:.|.:..|:.    .|...||||||:||:..||.
  Fly     3 DYSDLDRQIEQLKRCEIIKENEVKALCAKAREILVEEGNVQ----RVDSPVTVCGDIHGQFYDLK 63

  Fly   253 VVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFI 317
            .:....|.....| |:|.|||||||...:|..||||:|.:.:|:.:.|.|||||...:...|||.
  Fly    64 ELFKVGGDVPEKN-YLFMGDFVDRGYYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFY 127

  Fly   318 REVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTS-LDLIKSIDRGKYVSILR 381
            .|...||  ....:..:..|::.:|.|.::::.::..||||.|.|.. ||.|:||||.:.|.   
  Fly   128 DECLRKY--GSTAVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQYLDQIRSIDRKQEVP--- 187

  Fly   382 PPLTDGEPLDKTEWQQIFDIMWSDP--QATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRS 444
               .||         .:.|::||||  |...|..|   ||||..||.||...|.:.:.:..:.|:
  Fly   188 ---HDG---------PMCDLLWSDPEDQTGWGVSP---RGAGYLFGSDVVSQFNRTNDIDMICRA 237

  Fly   445 HECKPNGHEFMHDNKIITIFSASNY-YAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLSFKQ 507
            |:....|.::..:..::|::||.|| |..| |..|.:.||..|...||.:.:|..:::.:..|:
  Fly   238 HQLVMEGFKWHFNETVLTVWSAPNYCYRCG-NVAAILELNEYLHRDFVIFEAAPQESRGIPSKK 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 102/309 (33%)
EFh 616..681 CDD:238008
Pp4-19CNP_001285489.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 102/309 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438796
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.