DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and PpN58A

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_477384.1 Gene:PpN58A / 37493 FlyBaseID:FBgn0025573 Length:324 Species:Drosophila melanogaster


Alignment Length:370 Identity:113/370 - (30%)
Similarity:165/370 - (44%) Gaps:55/370 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LIKHMPQAAGRKN---QYQGSAHVSVLDDKDDLVEEFGDIVNAKIELPIRKNHIDLLIDVFRKKR 201
            ::|.:......||   ::....::..:..|..|:.|.|.:|...:.                   
  Fly     1 MMKKLLSNGSNKNKTLKFDEGINLDQIIAKLKLIGEIGSVVQISVR------------------- 46

  Fly   202 GNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNP 266
                  :..|:..|.....|||     |....:...:.:.||:||:..:||.....||.|..| .
  Fly    47 ------EIEAVCSRAREVLLKQ-----PTLLEIPAPINLLGDIHGQYLNLLRYFESNGYPPDS-V 99

  Fly   267 YVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRI 331
            |:..||:|||||:.:|.|.|||:|...:|...:|.|||||.|.:|..|||..|.:.:|  ..|..
  Fly   100 YLLLGDYVDRGKQSIETLTLLLALKARYPTKFYLLRGNHECSSINHFYGFYDECKRRY--TVKLW 162

  Fly   332 LAFIDEVYRWLPLGSVLNSRVLIVHGGFSDST-SLDLIKSIDRGKYVSILRPPLTDGEPLDKTEW 395
            ..|:| .|..|||.:::...:...|||.|... |:..|:.|.|               |::..|.
  Fly   163 RTFVD-CYNCLPLAAIIEENIFCCHGGLSPHLFSMQQIREIRR---------------PIEIPES 211

  Fly   396 QQIFDIMWSDPQ-ATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK 459
            ..|.||:||||. ..||..||. ||....||.||...||.|.:|:.:.|.|:...:|:||....:
  Fly   212 GLICDILWSDPDLRIMGWGPNE-RGVSHTFGSDVVSAFLHRFKLNLICRGHQVVEDGYEFFAKRQ 275

  Fly   460 IITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTKRLS 504
            :||||||.||.....|.||.:.:|..|:..|.......|:.:|||
  Fly   276 LITIFSAPNYCGEFDNAGAMMCINQDLLCTFRVQRPILSEQRRLS 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 101/311 (32%)
EFh 616..681 CDD:238008
PpN58ANP_477384.1 PTZ00480 22..311 CDD:185658 106/338 (31%)
MPP_superfamily 23..311 CDD:301300 106/337 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438798
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.