DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:311 Identity:90/311 - (28%)
Similarity:146/311 - (46%) Gaps:52/311 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 GNRLHPKYVALILR----------EAAKSLKQLPNI----------SPVSTAVSQQVTVCGDLHG 246
            |:.||.|...:|.|          :.....|::..|          .|:...:...||:|||:||
 Worm     9 GSPLHRKLTNVIFRLTQSWSPGNCQTLFQEKEIIEICYRAREAFWKEPMKLEIEAPVTICGDIHG 73

  Fly   247 KLDDLLVVLHKNGLP-----SSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHE 306
            :.:|||.:....|.|     ..|:.|:|.||::|||...:||:.||.:..|..|..:||.|||||
 Worm    74 QFEDLLSMFDIYGFPHVSQKDKSSRYLFLGDYIDRGPFSIEVITLLFAYRLLHPQKMFLLRGNHE 138

  Fly   307 DSVMNARYGFIREVESKYPRNHKRILAFIDEVYRW----LPLGSVLNSRVLIVHGGFS-DSTSLD 366
            ...:|.:|||..|.:.:|.       ..:.|.::|    :||.:::..|::.:|||.. ...||:
 Worm   139 SRPVNMQYGFYNECKRRYS-------VTLYETFQWAFYCMPLCAIVGGRIMCMHGGIPFGLLSLE 196

  Fly   367 LIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDN 431
            .|....|               |.|..:.....|:.|:||.:.:....::.||||..||......
 Worm   197 QIDEFQR---------------PTDIADVGIPSDLCWADPVSGVVGFQDSPRGAGHVFGEATVKE 246

  Fly   432 FLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRL 482
            |.::.:|..::|:|:...:|:||..|.|::|||||..|.....|.||.:::
 Worm   247 FNEKFKLDLIVRAHQVVMDGYEFFADKKLVTIFSAPCYCGHFDNLGAVLQV 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 90/311 (29%)
EFh 616..681 CDD:238008
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 84/284 (30%)
MPP_superfamily 36..304 CDD:301300 84/284 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.