DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and gsp-2

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001022616.1 Gene:gsp-2 / 3564807 WormBaseID:WBGene00001748 Length:333 Species:Caenorhabditis elegans


Alignment Length:324 Identity:101/324 - (31%)
Similarity:166/324 - (51%) Gaps:27/324 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 LPIRKNHIDLLIDVFRKKRGNRLHP-KYVALI---LREAAKSLKQLPNISPVSTAVSQQVTVCGD 243
            :.:.|.::|.:|....:.||::  | |.|.|.   ::...:..:::....|:...:...:.:|||
 Worm     1 MDVEKLNLDNIISRLLEVRGSK--PGKNVQLTESEIKGLCQKSREIFLSQPILLELEAPLKICGD 63

  Fly   244 LHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDS 308
            :||:..|||.:....|.|..|| |:|.||:|||||:.||.:.|||:..:.:|...||.|||||.:
 Worm    64 VHGQYYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECA 127

  Fly   309 VMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSID 372
            .:|..|||..|.:.:|  |.|....|.| .:..||:.::::.::...|||.| |..|::.|:.|.
 Worm   128 SINRIYGFYDECKRRY--NIKLWKTFTD-CFNCLPVAAIIDEKIFCCHGGLSPDLQSMEQIRRIM 189

  Fly   373 RGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHR 437
            |               |.|..:...:.|::||||...:.......||....|||:|...||.:|.
 Worm   190 R---------------PTDVPDQGLLCDLLWSDPDKDVTGWGENDRGVSFTFGPEVVAKFLHKHD 239

  Fly   438 LSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTK 501
            |..:.|:|:...:|:||....:::|:|||.||.....|.|:.:.::..||..| |.:..|.:.|
 Worm   240 LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGSMMTVDETLMCSF-QILKPADKKK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 99/314 (32%)
EFh 616..681 CDD:238008
gsp-2NP_001022616.1 PTZ00480 5..315 CDD:185658 101/320 (32%)
MPP_PP1_PPKL 7..297 CDD:277359 98/311 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.