DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and Y69E1A.4

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_502041.1 Gene:Y69E1A.4 / 190550 WormBaseID:WBGene00013476 Length:375 Species:Caenorhabditis elegans


Alignment Length:353 Identity:96/353 - (27%)
Similarity:151/353 - (42%) Gaps:73/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 YVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNP------- 266
            :.|..|.|.....::|....|:...:...:.|.||:||:.||||.:|..||.|.||..       
 Worm    36 FCAAELAELCHRARELIWSEPIFLKLEAPICVMGDIHGQFDDLLAMLDMNGWPLSSQEFEALKDT 100

  Fly   267 ----------------------------------------------YVFNGDFVDRGKRGLEVLL 285
                                                          |:|.||:||||...:||::
 Worm   101 TVRSRETGKRPQSEPHSTQPESSNDVKPPVAAPKSVNKEVTTGYKRYLFLGDYVDRGPFSMEVVI 165

  Fly   286 LLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNS 350
            ||.:|.||:|:.::|.|||||...:|..|||.|||..:|   ..::......::...|..:|:|:
 Worm   166 LLTALKLAYPDRIYLLRGNHESRSVNTSYGFYREVNYRY---DAQLYECFQNMFNVFPFCAVINN 227

  Fly   351 RVLIVHGGFSDS-TSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVP 414
            .::.:|||.|:. ||.:......|               ||:..:...:.|:.|:||..|.....
 Worm   228 TIMCMHGGISEHLTSFNQFSVFKR---------------PLEIPDVGVLTDLTWADPDPTEKGYK 277

  Fly   415 NTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAY 479
            .:.|||...|||.....||::..|..|||.|:...:|:||....:::|||||.||.....|..|.
 Worm   278 PSARGASFVFGPPALRAFLKKLDLQMVIRGHQVVEDGYEFFDGRRLVTIFSAPNYCGQNDNTAAV 342

  Fly   480 IRLNNQLMPHFVQYISAASQTKRLSFKQ 507
            ..::.:|... :......|:.|:..|::
 Worm   343 FSIDKKLKIS-INVFRPESRDKKRGFEK 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 93/338 (28%)
EFh 616..681 CDD:238008
Y69E1A.4NP_502041.1 PP2Ac 36..360 CDD:197547 93/342 (27%)
MPP_superfamily 39..358 CDD:301300 92/337 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.