DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and Ppp1ca

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_114074.1 Gene:Ppp1ca / 19045 MGIID:103016 Length:330 Species:Mus musculus


Alignment Length:320 Identity:102/320 - (31%)
Similarity:162/320 - (50%) Gaps:27/320 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 KNHIDLLIDVFRKKRGNRLHP-KYVALI---LREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGK 247
            |.::|.:|....:.:|:|  | |.|.|.   :|......:::....|:...:...:.:|||:||:
Mouse     6 KLNLDSIIGRLLEVQGSR--PGKNVQLTENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQ 68

  Fly   248 LDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNA 312
            ..|||.:....|.|..|| |:|.||:|||||:.||.:.|||:..:.:|...||.|||||.:.:|.
Mouse    69 YYDLLRLFEYGGFPPESN-YLFLGDYVDRGKQSLETICLLLAYKIRYPENFFLLRGNHECASINR 132

  Fly   313 RYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKY 376
            .|||..|.:.:|  |.|....|.| .:..||:.::::.::...|||.| |..|::.|:.|.|   
Mouse   133 IYGFYDECKRRY--NIKLWKTFTD-CFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMR--- 191

  Fly   377 VSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYV 441
                        |.|..:...:.|::||||...:.......||....||.:|...||.:|.|..:
Mouse   192 ------------PTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLI 244

  Fly   442 IRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYISAASQTK 501
            .|:|:...:|:||....:::|:|||.||.....|.||.:.::..||..| |.:..|.:.|
Mouse   245 CRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSF-QILKPADKNK 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 100/311 (32%)
EFh 616..681 CDD:238008
Ppp1caNP_114074.1 PTZ00480 6..308 CDD:185658 102/320 (32%)
MPP_PP1_PPKL 8..298 CDD:277359 99/311 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 306..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.