DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and T16G12.7

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_499229.1 Gene:T16G12.7 / 188557 WormBaseID:WBGene00011808 Length:319 Species:Caenorhabditis elegans


Alignment Length:322 Identity:93/322 - (28%)
Similarity:159/322 - (49%) Gaps:32/322 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 VNAKIELPIRKNHIDLLIDVFRKKRGNR----LHPKYVALILREAAKS--LKQLPNISPVSTAVS 235
            ||.|.:|    |..|:::.:.....|..    :..:...:.|.:|||.  :||     .....:.
 Worm    11 VNNKSDL----NVDDIIVKILNIGSGGNNFEAIMSQKTLVSLLDAAKDVFMKQ-----GAMLELE 66

  Fly   236 QQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFL 300
            ..|.:|||:||:..|:|.:..:.|.|...| |:|.||:||||::.|||..|.|:..:.||...|:
 Worm    67 APVKICGDVHGQYSDVLRLFDRGGFPPLVN-YLFLGDYVDRGQQSLEVACLFLAYKVKFPGNFFM 130

  Fly   301 NRGNHEDSVMNARYGFIREVESKY-PRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSD-ST 363
            .|||||...:|..|||:.||:.|| .:....:.......:.::|..::::.|:|.:|||.|. ..
 Worm   131 LRGNHECGSINRVYGFLDEVQRKYGAKGGTTMWNCFQICFAYMPYTALVSGRILCMHGGISKRMN 195

  Fly   364 SLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDV 428
            :|:.::::.        ||.|....|..:      .||:||||.:|:....::.||.|..||...
 Worm   196 NLNQLRNLQ--------RPVLEVANPSVE------IDILWSDPDSTVDDFVDSTRGVGQVFGAKA 246

  Fly   429 TDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHF 490
            ....:.:..:..|.|:|:...:|:||.::.:::|||||.:|.....|..|.:.::..|...|
 Worm   247 LTAIMNKLDVDLVARAHQVVQDGYEFFNNKRLVTIFSAPHYCGEFDNAAAMMNVDKNLTCSF 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 89/315 (28%)
EFh 616..681 CDD:238008
T16G12.7NP_499229.1 MPP_superfamily 18..313 CDD:301300 89/311 (29%)
PP2Ac 40..313 CDD:197547 86/289 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.