DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and C09H5.7

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_505086.2 Gene:C09H5.7 / 182476 WormBaseID:WBGene00015661 Length:333 Species:Caenorhabditis elegans


Alignment Length:264 Identity:81/264 - (30%)
Similarity:137/264 - (51%) Gaps:21/264 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 PVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLA 293
            ||...|...:.||||:||:..|::.:......|..|| |:|.||:||||::.||::.|.|...:.
 Worm    74 PVMLEVDAPIKVCGDVHGQYSDVIRMFSIARFPPHSN-YIFLGDYVDRGRQNLELITLFLCYKIK 137

  Fly   294 FPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGG 358
            |.:..::.|||||...:|..|||..|...:|...  |:.....|.:..:|...:::.|:|.:|||
 Worm   138 FYDRFYMLRGNHECPAVNRVYGFYEECNKRYAST--RLWLAFQEAFAAMPFTGLISGRILCMHGG 200

  Fly   359 FSDS-TSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDP-QATMGCVPNTLRGAG 421
            .|.. |:||:::.:.|               |:|........|::|||| .:.:..:|| :||..
 Worm   201 LSPKLTNLDVLRDLTR---------------PMDPPSPSLHIDLLWSDPDNSVIDWLPN-VRGVS 249

  Fly   422 VWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQL 486
            ..|||:|....::...:..:.|:|:...:|:||..:.|::|||||.:|.....|..|.:.:::.|
 Worm   250 YIFGPNVVKKQIETLGIDLIARAHQVVQDGYEFFAEKKLVTIFSAPHYCGQFDNSAAIMNVDDNL 314

  Fly   487 MPHF 490
            :..|
 Worm   315 ICSF 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 81/264 (31%)
EFh 616..681 CDD:238008
C09H5.7NP_505086.2 MPP_superfamily 32..323 CDD:301300 81/264 (31%)
PP2Ac 56..323 CDD:197547 81/264 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.