DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and C47A4.3

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_502650.1 Gene:C47A4.3 / 178340 WormBaseID:WBGene00008124 Length:316 Species:Caenorhabditis elegans


Alignment Length:317 Identity:104/317 - (32%)
Similarity:163/317 - (51%) Gaps:35/317 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 IRKNHID-LLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTA------VSQQVTVCG 242
            ::.|.:| ::|||....    .|.|.:..::.| .:.||.|.....|..|      |:..:.|||
 Worm     1 MQNNVVDSIIIDVLSAS----THEKPLCKVITE-ERVLKLLDLALGVFKAQKPMVEVNAPIKVCG 60

  Fly   243 DLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHED 307
            |:||:..|||.:.|:.|.|.::| |:|.||:||||:..:|.::|||:..:.||...||.|||||.
 Worm    61 DIHGQFPDLLRLFHRGGWPPTAN-YLFLGDYVDRGRFSIETIVLLLAYKVKFPCNFFLLRGNHEC 124

  Fly   308 SVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS----DSTSLDLI 368
            ..:|..|||..|.:.:|  ...|:.|...:|:.||||..::.:::|.:|||.|    ...:||.:
 Worm   125 EFVNKTYGFYEECQKRY--QSVRMYAAFQDVFNWLPLTGLIATKILCMHGGLSPLMTKEFTLDTL 187

  Fly   369 KSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFL 433
            :.|:|         |....|.|       :.|::|:||.:.:....|..||||..||.|...|..
 Worm   188 RKIER---------PTEGKEGL-------VADLLWADPISGLSGFMNNQRGAGCGFGRDSVLNLC 236

  Fly   434 QRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHF 490
            ...:|..|.|:|:...:|:||....|::|||||.:|.....|..|::..:.:|...|
 Worm   237 SEFQLDLVCRAHQVVQDGYEFFAGRKLVTIFSAPHYCGQFDNCAAFMSCDEKLQCSF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 104/317 (33%)
EFh 616..681 CDD:238008
C47A4.3NP_502650.1 MPP_superfamily 5..298 CDD:301300 103/313 (33%)
PP2Ac 27..299 CDD:197547 97/287 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.