DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and pph-4.1

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_499603.1 Gene:pph-4.1 / 176657 WormBaseID:WBGene00004085 Length:333 Species:Caenorhabditis elegans


Alignment Length:319 Identity:105/319 - (32%)
Similarity:160/319 - (50%) Gaps:38/319 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HIDLLIDVFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLV 253
            ||:.|:      |...:..:.|..:..:|.:.|.:..|:.    .:...||:|||:||:..||: 
 Worm    35 HIEKLM------RCELIAEQDVKTLCAKAREILAEEGNVQ----VIDSPVTICGDIHGQFYDLM- 88

  Fly   254 VLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIR 318
            .|.|.|.|..:..|:|.|||||||...:|..||||:|...:|:.:.|.|||||...:...|||..
 Worm    89 ELFKVGGPVPNTNYLFLGDFVDRGFYSVETFLLLLALKARYPDRMMLIRGNHESRQITQVYGFYD 153

  Fly   319 EVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDSTS-LDLIKSIDRGKYVSILRP 382
            |...||  .:..:.....||:.:|.|.:|::.:|..||||.|.|.| :|.|:.|||.:.|.    
 Worm   154 ECLRKY--GNASVWKHCTEVFDYLSLAAVIDGKVFCVHGGLSPSISTMDQIRVIDRKQEVP---- 212

  Fly   383 PLTDGEPLDKTEWQQIFDIMWSDPQ---ATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRS 444
              .||         .:.|::||||:   ...|..|   ||||..||.|.:..|.:.:.:..:.|:
 Worm   213 --HDG---------PMCDLLWSDPEEGNVGWGLSP---RGAGYLFGADASKTFCETNGVDLICRA 263

  Fly   445 HECKPNGHEFMHDNKIITIFSASNY-YAIGSNKGAYIRLNNQLMPHFVQYISAASQTKR 502
            |:....|:::..:.|::|::||.|| |..| |..|.:.|:..|...|..: .||.|..|
 Worm   264 HQLVMEGYKWHFNEKVLTVWSAPNYCYRCG-NVAAILELDENLNKEFTIF-EAAPQENR 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 101/309 (33%)
EFh 616..681 CDD:238008
pph-4.1NP_499603.1 PTZ00239 31..333 CDD:173488 105/319 (33%)
MPP_PP2A_PP4_PP6 31..316 CDD:277360 102/313 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.