DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and F58G1.3

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_496754.2 Gene:F58G1.3 / 174933 WormBaseID:WBGene00010265 Length:364 Species:Caenorhabditis elegans


Alignment Length:375 Identity:101/375 - (26%)
Similarity:162/375 - (43%) Gaps:78/375 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 AELYKFFNDLIKHMPQAAGRKNQYQGSAHVSVLDDKDDLVEEFGDIVNAKIELPIRKNHIDLLID 195
            :|:.||  ||.|..|:.|               :..||.::....:            :.|..|:
 Worm    19 SEISKF--DLAKENPRLA---------------EWMDDCIKRMNSL------------YKDTNIN 54

  Fly   196 VFRKKRGNRLHPKYVALILREAAKSLKQLPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNG- 259
            :.....|:.     :..|:|..........|:......:.    |.||:|.:..|:..:....| 
 Worm    55 ICNVMTGHE-----IIAIIRMVEAIFMDESNLCEAEAPIK----VIGDIHAQFQDMNRLFDLIGR 110

  Fly   260 LPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKY 324
            :|...  .:|.||:||||.:|:|||:||..|.:.:.:.::|.|||||...:|..|||..|.:.||
 Worm   111 VPEEK--LMFLGDYVDRGPQGIEVLILLFCLKIRYRDRIYLLRGNHETPSVNKIYGFYVECQYKY 173

  Fly   325 PRNHKRILAFIDEVYRW---------LPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYVSI 379
                        .|..|         :|:..:::.|||.:|||.| :..:||.|::|.|      
 Worm   174 ------------GVGLWWDFQTCFNRMPMSGLISKRVLCMHGGLSPELINLDTIRNIPR------ 220

  Fly   380 LRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRS 444
               |.   ||||:   ..:.|::||||........:::||....||..|.:...:...:..:||.
 Worm   221 ---PC---EPLDR---GLLIDLLWSDPTNKGEGWFHSIRGISYMFGKGVVEQACKSLEIDLIIRG 276

  Fly   445 HECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFVQYI 494
            |:...:|:|.|...::||:||..||.|..:|..|.:.||..|...|.|.|
 Worm   277 HQVVQDGYEMMAGRRLITVFSVPNYCAQFTNAAAVVCLNANLQVSFQQLI 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 90/320 (28%)
EFh 616..681 CDD:238008
F58G1.3NP_496754.2 MPP_superfamily 37..327 CDD:301300 93/340 (27%)
PP2Ac 59..329 CDD:197547 89/306 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.