DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and gsp-3

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_491429.1 Gene:gsp-3 / 172082 WormBaseID:WBGene00021113 Length:305 Species:Caenorhabditis elegans


Alignment Length:271 Identity:88/271 - (32%)
Similarity:137/271 - (50%) Gaps:21/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 VSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAV 298
            |...:.||||:||:..|||.:..|||.|...| ::|.||:||||::.:|.:.|:|...:.:|...
 Worm    53 VEPPIIVCGDIHGQYSDLLRIFDKNGFPPDVN-FLFLGDYVDRGRQNIETICLMLCFKIKYPENF 116

  Fly   299 FLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFSDS- 362
            |:.|||||...:|..|||..|...:|  ...|:.:...:.:.|:||..::.||:|.:|||.|.. 
 Worm   117 FMLRGNHECPAINRVYGFYEECNRRY--KSTRLWSIFQDTFNWMPLCGLIGSRILCMHGGLSPHL 179

  Fly   363 TSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDP-QATMGCVPNTLRGAGVWFGP 426
            .:||.::.:.|               |.|........|::|:|| |...|...|| ||....||.
 Worm   180 QTLDQLRQLPR---------------PQDPPNPSIGIDLLWADPDQWVKGWQANT-RGVSYVFGQ 228

  Fly   427 DVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHFV 491
            ||..:...|..:..|.|:|:...:|:||....|::|||||.:|.....|..|.::::..::..||
 Worm   229 DVVADVCSRLDIDLVARAHQVVQDGYEFFASKKMVTIFSAPHYCGQFDNSAATMKVDENMVCTFV 293

  Fly   492 QYISAASQTKR 502
            .|.......:|
 Worm   294 MYKPTPKSMRR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 86/261 (33%)
EFh 616..681 CDD:238008
gsp-3NP_491429.1 MPP_superfamily 6..297 CDD:301300 87/262 (33%)
PP2Ac 29..299 CDD:197547 87/264 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.