DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rdgC and ppp1cb

DIOPT Version :9

Sequence 1:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster
Sequence 2:NP_001004527.2 Gene:ppp1cb / 100003223 ZFINID:ZDB-GENE-030616-609 Length:327 Species:Danio rerio


Alignment Length:307 Identity:95/307 - (30%)
Similarity:152/307 - (49%) Gaps:26/307 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 HIDLLIDVFRKKRGNRLHPKYVALILREAAKSL----KQLPNISPVSTAVSQQVTVCGDLHGKLD 249
            ::|.||....:.||.|  |..:..:.....:.|    :::....|:...:...:.:|||:||:..
Zfish     7 NVDSLISRLLEVRGCR--PGKIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYT 69

  Fly   250 DLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLLSLYLAFPNAVFLNRGNHEDSVMNARY 314
            |||.:....|.|..:| .:|.||:|||||:.||.:.|||:..:.:|...||.|||||.:.:|..|
Zfish    70 DLLRLFEYGGFPPEAN-NLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIY 133

  Fly   315 GFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVLIVHGGFS-DSTSLDLIKSIDRGKYVS 378
            ||..|.:.::  |.|....|.| .:..||:.::::.::...|||.| |..|::.|:.|.|     
Zfish   134 GFYDECKRRF--NIKLWKTFTD-CFNCLPIAAIIDEKIFCCHGGLSPDLQSMEQIRRIMR----- 190

  Fly   379 ILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMGCVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIR 443
                      |.|..:...:.|::||||...:.......||....||.||...||.||.|..:.|
Zfish   191 ----------PTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRHDLDLICR 245

  Fly   444 SHECKPNGHEFMHDNKIITIFSASNYYAIGSNKGAYIRLNNQLMPHF 490
            :|:...:|:||....:::|:|||.||.....|.|..:.::..||..|
Zfish   246 AHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGGMMSVDESLMCSF 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 95/307 (31%)
EFh 616..681 CDD:238008
ppp1cbNP_001004527.2 PTZ00480 3..300 CDD:185658 95/307 (31%)
MPP_PP1_PPKL 7..297 CDD:277359 95/307 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.