DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6951 and Cdadc1

DIOPT Version :10

Sequence 1:NP_649197.1 Gene:CG6951 / 40222 FlyBaseID:FBgn0036959 Length:203 Species:Drosophila melanogaster
Sequence 2:NP_001386504.1 Gene:Cdadc1 / 361052 RGDID:1311845 Length:523 Species:Rattus norvegicus


Alignment Length:141 Identity:44/141 - (31%)
Similarity:61/141 - (43%) Gaps:30/141 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 MATSLLSAKRSKDPVTQVGACI-VDSQNR---------IVAIGYNGFPRNCSDDVFPWSKAKKGS 87
            |..:.|.|.|::|..|.|||.| .::::|         .|..|||.||.......||....|...
  Rat   324 MVQARLLAYRTEDHKTGVGAVIWAEAKSRSCDGTGAMYFVGCGYNAFPVGSEYADFPHMDDKHKD 388

  Fly    88 QEFDPLEDKKMYVVHAEANAI------LNSNGMSLSGTRLYTTLFPCNECAKLIIQVGISQVLYL 146
            :|.    .|..|::|||.||:      :.....|:    ::.|..||:||..||...||.|: |.
  Rat   389 REI----RKFRYIIHAEQNALTFRCQDIKPEERSM----IFVTKCPCDECVPLIKGAGIKQI-YA 444

  Fly   147 SD-----KYAD 152
            .|     |.||
  Rat   445 GDVDVGKKKAD 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6951NP_649197.1 ComEB 21..179 CDD:441734 44/141 (31%)
Cdadc1NP_001386504.1 cytidine_deaminase-like 75..152 CDD:444801
deoxycytidylate_deaminase 320..455 CDD:238613 42/139 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.