DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and CLC1

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_011683.3 Gene:CLC1 / 853077 SGDID:S000003399 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:59/230 - (25%)
Similarity:95/230 - (41%) Gaps:40/230 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 DFAAKEDVDPAAEFLAREQSALGD---------LEAEITGGSASAPPAASTDEGLGELLGGTASE 61
            ||...:..|...:||.||...|||         ||.|       |.||...|    |:.......
Yeast    14 DFTPNDKKDDDTDFLKREAEILGDEFKTEQDDILETE-------ASPAKDDD----EIRDFEEQF 67

  Fly    62 GDLLSAGGTGGLESSTGSFEVIGGESN----------EPVGISGPPPSREEPEKIRKWREEQKQR 116
            .|:.||.|....:.: ||..|..|..|          |....|......:..|.:.:|::.:...
Yeast    68 PDINSANGAVSSDQN-GSATVSSGNDNGEADDDFSTFEGANQSTESVKEDRSEVVDQWKQRRAVE 131

  Fly   117 LEEKDIEEERKKEELRQQSKKELDDWLRQIGESISKTKL-----ASRNAEKQAATLENGTIEPGT 176
            :.|||:::|..|:||:.::.|.:||:.    :|.:|.|.     |::.||......:....:..|
Yeast   132 IHEKDLKDEELKKELQDEAIKHIDDFY----DSYNKKKEQQLEDAAKEAEAFLKKRDEFFGQDNT 192

  Fly   177 EWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQN 211
            .|:|..:|.:.:......|:|.|:::.|.|.||.|
Yeast   193 TWDRALQLINQDDADIIGGRDRSKLKEILLRLKGN 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 59/230 (26%)
CLC1NP_011683.3 Clathrin_lg_ch 1..227 CDD:395863 58/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4031
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103026
Panther 1 1.100 - - LDO PTHR10639
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R206
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.