DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and cltb

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_012814356.1 Gene:cltb / 496489 XenbaseID:XB-GENE-954481 Length:223 Species:Xenopus tropicalis


Alignment Length:234 Identity:80/234 - (34%)
Similarity:123/234 - (52%) Gaps:40/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DDF-------AAKEDVDPAAEFLAREQSALGDLEAEITGGSASAPPAASTDEGLGELLGGT-ASE 61
            |||       |.:.:.||||.|||:::|.:..:|               .|||.|.:.|.: ..|
 Frog     3 DDFGFFETGAAGETEEDPAAAFLAQQESEIAGIE---------------NDEGFGVVQGDSPEEE 52

  Fly    62 GDLLSAGGTGGLESSTGSFEVIGGESNEPVGISGPPPSREEPEKIRKWREEQKQRLEEKDIEEER 126
            .:::.....|.:..:...::.....|:....|:......:|||.:||||||||.||||.|...:.
 Frog    53 PEMVDFNDFGTIPMNGELYQETSDYSDGYAAIAQADRLTQEPESLRKWREEQKTRLEELDAASKV 117

  Fly   127 KKEELRQQSKKELDDWLRQIGESISKTKLASRNAEK-----------------QAATLENGTIEP 174
            .::|.|:::||:||:|.::..|.|.|.|:::|.|:|                 :|...:....|.
 Frog   118 TEQEWREKAKKDLDEWYQRQSEQIEKNKVSNRIADKAFYQQPNAEVIGYVASDEAMASDTKEEET 182

  Fly   175 GTEWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQNPI 213
            ||||||:|:|||||||.:|..|||||:||:.:.|||.|:
 Frog   183 GTEWERVARLCDFNPKSSKQSKDVSRLRSVLISLKQTPL 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 78/230 (34%)
cltbXP_012814356.1 Clathrin_lg_ch 1..219 CDD:366457 78/230 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I5064
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 133 1.000 Inparanoid score I4478
OMA 1 1.010 - - QHG46883
OrthoDB 1 1.010 - - D1577821at2759
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - otm48022
Panther 1 1.100 - - LDO PTHR10639
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3012
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.