DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and clta

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_998210.1 Gene:clta / 406318 ZFINID:ZDB-GENE-040426-1986 Length:235 Species:Danio rerio


Alignment Length:239 Identity:83/239 - (34%)
Similarity:115/239 - (48%) Gaps:63/239 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 DVDPAAEFLAREQSALGDLEAEITG----GSASAPPAASTDEGLGELLGGTASEGDLLSAGGTGG 72
            |.||||.|||:::|.:..:|.: .|    .|...|.:.|.|:      .|.|..|||        
Zfish    21 DEDPAAAFLAQQESEIAGIEND-EGFSILDSGDVPSSLSQDQ------DGGAMNGDL-------- 70

  Fly    73 LESSTGSFEVIGGESNEP----VGISGPPPSREEPEKIRKWREEQKQRLEEKDIEEERKKEELRQ 133
                       .||||.|    ..||.....:.|||.:|||||||:.||||.|....:::.|.::
Zfish    71 -----------HGESNGPSDVYAAISSVDRLQAEPESLRKWREEQRDRLEELDANSRKQEAEWKE 124

  Fly   134 QSKKELDDWLRQIGESISKTKLASR-----------------------------NAEKQAATLEN 169
            ::|.||::|..:..|.:.|||:.:|                             .|.::|...|.
Zfish   125 KAKLELEEWHTRQNEQLEKTKVNNRVLDEDFYKQPFADLIGYVTHINHPCYRLDQAAEEAMVSEL 189

  Fly   170 GTIEPGTEWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQNPI 213
            ....|||||||:|:|||||||.:|..||||||||:.:.|||.|:
Zfish   190 DENSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 82/236 (35%)
cltaNP_998210.1 Clathrin_lg_ch 1..234 CDD:279433 83/239 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590672
Domainoid 1 1.000 129 1.000 Domainoid score I5216
eggNOG 1 0.900 - - E1_KOG4031
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1384
Inparanoid 1 1.050 131 1.000 Inparanoid score I4611
OMA 1 1.010 - - QHG46883
OrthoDB 1 1.010 - - D1577821at2759
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - otm25180
orthoMCL 1 0.900 - - OOG6_103026
Panther 1 1.100 - - O PTHR10639
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R206
SonicParanoid 1 1.000 - - X3012
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.