DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and clta

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_012813602.1 Gene:clta / 394591 XenbaseID:XB-GENE-944169 Length:233 Species:Xenopus tropicalis


Alignment Length:247 Identity:86/247 - (34%)
Similarity:121/247 - (48%) Gaps:63/247 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDDFAAKEDVDPAAEFLAREQSALGDLEAEITGGSASAPPAASTDEGLGELLGGTASEGDLLSAG 68
            |:..:|:|  ||||.|||:::|.:..:|               .|||...|..|   |..:....
 Frog    11 GNGVSAEE--DPAAAFLAQQESEIAGIE---------------NDEGFSILDSG---EVPMSLQA 55

  Fly    69 GTGGLESSTGSFEVIGG----ESNEP----VGISGPPPSREEPEKIRKWREEQKQRLEEKDIEEE 125
            |.|..::      |:.|    |:|.|    ..||.....:.|||.||||||||:.|||..|...:
 Frog    56 GDGATDT------VMNGDFYQETNGPTDGYAAISHADRLQAEPESIRKWREEQRSRLEMLDANSK 114

  Fly   126 RKKEELRQQSKKELDDWLRQIGESISKTKLASRNAE----KQ---------------AATLENGT 171
            :::.|.:.::.|||::|..:..|.:.|||..:|.|:    ||               ..:||...
 Frog   115 KQETEWKDKAGKELEEWYARQDELLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAA 179

  Fly   172 IE----------PGTEWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQNPI 213
            .|          |||||||:|:|||||||.:|..||||||||:.:.|||.|:
 Frog   180 EEAFVSDVEETSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 84/242 (35%)
cltaXP_012813602.1 Clathrin_lg_ch 10..228 CDD:366457 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 132 1.000 Domainoid score I5064
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H1384
Inparanoid 1 1.050 133 1.000 Inparanoid score I4478
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1577821at2759
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - otm48022
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R206
SonicParanoid 1 1.000 - - X3012
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.