DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and clc1

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_595750.1 Gene:clc1 / 2541305 PomBaseID:SPBC9B6.08 Length:229 Species:Schizosaccharomyces pombe


Alignment Length:237 Identity:61/237 - (25%)
Similarity:96/237 - (40%) Gaps:58/237 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DFGDDF--AAKEDVDPAAEFLAREQSALG--------------------DLEAEITGGSASAPPA 44
            ||.|..  |..:|.....:||.||:.|||                    |.|||.|....:.||.
pombe     9 DFDDGLVTAPVDDSKNNTDFLEREKLALGEDAGQFETPEDKDALLNFENDSEAEQTRFEQNFPPI 73

  Fly    45 ASTDEGLGELLGGTASEGDLLSAGGTGGLESS--TGSFEVIGGESNEPVGISGPPPSRE--EPEK 105
            .:.                 :.|.||.....:  .|..||             .||..|  :||.
pombe    74 DAE-----------------MQASGTFSAPKAPYMGQAEV-------------HPPEDESGDPEP 108

  Fly   106 IRKWREEQKQRLEEKDIEEERKKEELRQQSKKELDDWLRQIGESISKTKLASRNAEKQAATLENG 170
            :|||:|:|.:|::|:|...::.:|...::::|.:||:.....:...|. :|....|::....||.
pombe   109 VRKWKEDQMKRIQERDESSKKLRESNIEKARKAIDDFYENFNDKRDKV-IAKSRKEQEKLLEENE 172

  Fly   171 TIEPG-TEWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQN 211
            :...| |.||||.||.|.:.|....|:...|.|.:.:.|.::
pombe   173 SKSTGTTSWERILKLIDLSDKPEAHGRSTERFRELLISLAKD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 58/233 (25%)
clc1NP_595750.1 Clathrin_lg_ch 1..220 CDD:279433 61/237 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 69 1.000 Domainoid score I2684
eggNOG 1 0.900 - - E1_KOG4031
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I1935
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - oto100859
orthoMCL 1 0.900 - - OOG6_103026
Panther 1 1.100 - - LDO PTHR10639
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R206
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.850

Return to query results.
Submit another query.