DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and clic-1

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_504999.1 Gene:clic-1 / 179150 WormBaseID:WBGene00020246 Length:226 Species:Caenorhabditis elegans


Alignment Length:228 Identity:72/228 - (31%)
Similarity:107/228 - (46%) Gaps:40/228 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPAAEFLAREQSALGDLEAEITGGSASAP-------PAASTDEGLGEL-LGG---------TASE 61
            ||.|:||||||:...|.:......:|:.|       ||.:.|:..|:| :.|         |.|.
 Worm     3 DPVADFLAREQNLFADFDGAPPAAAAANPDAPEADAPAPALDDDFGDLQIAGDEPPPVVHPTDSG 67

  Fly    62 GDLLSAGGTGGLESSTGSFEVI----------GGESNEPVGISGPPP-----SREEPEKIRKWRE 111
            .||      .||.....:...|          |..|....|..||.|     .|.|.||||.|:.
 Worm    68 VDL------DGLVDDNAAAPAIVVPAVEPMVNGNHSASSGGSKGPSPILSTVPRIEAEKIRLWKA 126

  Fly   112 EQKQRLEEKDIEEERKKEELRQQSKKELDDWLRQIGESISKTKLASRNAEKQAATLENGTIEPGT 176
            :|:|.|.:||..||:||.|||..:||||::|.:|..:::..:...:...||....|.....:...
 Worm   127 QQEQLLSKKDEAEEKKKIELRANAKKELEEWYKQREKTLQLSHDENLKNEKSNQELFAKQQDGDA 191

  Fly   177 EWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLK 209
            :||.:.||.|  .:.:|:|||:||::::...||
 Worm   192 QWETVNKLVD--QQKSKSGKDLSRLKTLLAGLK 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 72/228 (32%)
clic-1NP_504999.1 Clathrin_lg_ch 2..222 CDD:279433 70/226 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165469
Domainoid 1 1.000 92 1.000 Domainoid score I4830
eggNOG 1 0.900 - - E1_KOG4031
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 92 1.000 Inparanoid score I3662
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - oto18495
orthoMCL 1 0.900 - - OOG6_103026
Panther 1 1.100 - - LDO PTHR10639
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R206
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.780

Return to query results.
Submit another query.