DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and CLTB

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_009028.1 Gene:CLTB / 1212 HGNCID:2091 Length:229 Species:Homo sapiens


Alignment Length:242 Identity:83/242 - (34%)
Similarity:125/242 - (51%) Gaps:50/242 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DDF------------AAKEDVDPAAEFLAREQSALGDLEAE----ITGGSASAPPAASTDEGLGE 53
            |||            ||:|  ||||.|||:::|.:..:|.:    ...||.:||.......|.|.
Human     3 DDFGFFSSSESGAPEAAEE--DPAAAFLAQQESEIAGIENDEGFGAPAGSHAAPAQPGPTSGAGS 65

  Fly    54 LLGGTASEGDLLSAGGTGGLESSTGSFEVIGGESNEPVGISGPPPSREEPEKIRKWREEQKQRLE 118
            ...||...||:               |:...|.::....|:......:|||.||||||||::||:
Human    66 EDMGTTVNGDV---------------FQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQ 115

  Fly   119 EKDIEEERKKEELRQQSKKELDDWLRQIGESISKTKLASRNAEK-----------------QAAT 166
            |.|...:..::|.|:::||:|::|.::..|.:.|.|:.:|.|:|                 :|..
Human   116 ELDAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADIIGYVASEEAFV 180

  Fly   167 LENGTIEPGTEWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQNPI 213
            .|:....||||||::|:|||||||.:|..|||||:||:.:.|||.|:
Human   181 KESKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 81/238 (34%)
CLTBNP_009028.1 Clathrin_lg_ch 1..225 CDD:395863 81/238 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..82 26/95 (27%)
Involved in binding clathrin heavy chain 93..155 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155510
Domainoid 1 1.000 131 1.000 Domainoid score I5149
eggNOG 1 0.900 - - E1_KOG4031
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 132 1.000 Inparanoid score I4621
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46883
OrthoDB 1 1.010 - - D1577821at2759
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - otm40822
orthoMCL 1 0.900 - - OOG6_103026
Panther 1 1.100 - - LDO PTHR10639
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R206
SonicParanoid 1 1.000 - - X3012
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.