DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and CLTA

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_009027.1 Gene:CLTA / 1211 HGNCID:2090 Length:248 Species:Homo sapiens


Alignment Length:247 Identity:87/247 - (35%)
Similarity:120/247 - (48%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GDDFAAKEDVDPAAEFLAREQSALGDLEAEITGGSASAPPAASTDEGLGELLGGTASEGDLLSAG 68
            |:..|...:.||||.|||:::|.:..:|               .||....|.||  :.|......
Human    20 GNGVAGAGEEDPAAAFLAQQESEIAGIE---------------NDEAFAILDGG--APGPQPHGE 67

  Fly    69 GTGGLESSTGSFEVIGG----ESNEP----VGISGPPPSREEPEKIRKWREEQKQRLEEKDIEEE 125
            ..||.::..|   |:.|    |||.|    ..||.....:.|||.||||||||.:|||..|....
Human    68 PPGGPDAVDG---VMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQMERLEALDANSR 129

  Fly   126 RKKEELRQQSKKELDDWLRQIGESISKTKLASRNAE----KQ---------------AATLENGT 171
            :::.|.::::.|||::|..:..|.:.|||..:|.|:    ||               ..:||...
Human   130 KQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYVTNINHPCYSLEQAA 194

  Fly   172 IE----------PGTEWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQNPI 213
            .|          |||||||:|:|||||||.:|..||||||||:.:.|||.|:
Human   195 EEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 85/242 (35%)
CLTANP_009027.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..92 26/91 (29%)
Clathrin_lg_ch 20..243 CDD:395863 84/242 (35%)
Involved in binding clathrin heavy chain 100..162 24/61 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165155509
Domainoid 1 1.000 131 1.000 Domainoid score I5149
eggNOG 1 0.900 - - E1_KOG4031
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1384
Inparanoid 1 1.050 132 1.000 Inparanoid score I4621
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46883
OrthoDB 1 1.010 - - D1577821at2759
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - otm40822
orthoMCL 1 0.900 - - OOG6_103026
Panther 1 1.100 - - O PTHR10639
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R206
SonicParanoid 1 1.000 - - X3012
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.