DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and Cltb

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_446287.1 Gene:Cltb / 116561 RGDID:621353 Length:229 Species:Rattus norvegicus


Alignment Length:240 Identity:84/240 - (35%)
Similarity:128/240 - (53%) Gaps:44/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DFGDDFAAKE-------DVDPAAEFLAREQSALGDLEAEITGGSASAPPAASTDEGLGELLG--- 56
            ||| .|::.|       :.||||.|||:::|.:..:|.:...|:.:|...||...||....|   
  Rat     4 DFG-FFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDSGFGAPAASQVASAQPGLASGGGSED 67

  Fly    57 -GTASEGDLLSAGGTGGLESSTGSFEVIGGESNEPVGISGPPPSREEPEKIRKWREEQKQRLEEK 120
             ||...||:               |:...|.::....|:......:|||.|||||||||:||:|.
  Rat    68 MGTTVNGDV---------------FQEANGPADGYAAIAQADRLTQEPESIRKWREEQKKRLQEL 117

  Fly   121 DIEEERKKEELRQQSKKELDDWLRQIGESISKTKLASRNAEK-----------------QAATLE 168
            |...:..::|.|:::||:|::|.::..|.:.|.|:.:|.|:|                 :|...|
  Rat   118 DAASKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADTIGYVASEEAFVKE 182

  Fly   169 NGTIEPGTEWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQNPI 213
            :....||||||::|:|||||||.:|..|||||:||:.:.|||.|:
  Rat   183 SKEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPL 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 80/233 (34%)
CltbNP_446287.1 Clathrin_lg_ch 1..225 CDD:395863 82/236 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..80 26/91 (29%)
Involved in binding clathrin heavy chain 93..155 25/61 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349394
Domainoid 1 1.000 134 1.000 Domainoid score I4880
eggNOG 1 0.900 - - E1_KOG4031
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I4483
OMA 1 1.010 - - QHG46883
OrthoDB 1 1.010 - - D1577821at2759
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - otm44965
orthoMCL 1 0.900 - - OOG6_103026
Panther 1 1.100 - - LDO PTHR10639
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3012
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.770

Return to query results.
Submit another query.