DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Clc and cltb

DIOPT Version :9

Sequence 1:NP_001163480.1 Gene:Clc / 40221 FlyBaseID:FBgn0024814 Length:219 Species:Drosophila melanogaster
Sequence 2:XP_005168279.1 Gene:cltb / 100329879 ZFINID:ZDB-GENE-101005-2 Length:226 Species:Danio rerio


Alignment Length:239 Identity:89/239 - (37%)
Similarity:126/239 - (52%) Gaps:45/239 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DFGDDFAAKE-----DVDPAAEFLAREQSALGDLEAEITGGS-----ASAPPAASTDEGLGELLG 56
            |||  |:|.:     :.||||.|||::::.:..:|.:.||.|     .:||....|..| |:..|
Zfish     4 DFG--FSAFDNGVHTEEDPAAAFLAQQENEIAVIENDSTGFSLPEDGGAAPADTYTMSG-GDFGG 65

  Fly    57 GTASEGDLLSAGGTGGLESSTGSFEVIGGESNEPVGISGPPPSREEPEKIRKWREEQKQRLEEKD 121
            .:|..||:..  .|.|:   |.|:..|.     .|.|     .|:|||.:||||||||.||||.|
Zfish    66 SSAVNGDMFQ--DTNGM---TDSYSAIA-----QVDI-----QRQEPESLRKWREEQKTRLEELD 115

  Fly   122 IEEERKKEELRQQSKKELDDWLRQIGESISKTKLASRNAEKQAATLENGTI-------------- 172
            ...:..:...|:::||||:||.....|.:.|.|:.:|.|:|......|..:              
Zfish   116 SASKAAEAVWREKAKKELEDWHIHQTEQMEKNKVNNRIADKAFYKQPNSDVIGFVASEEAFLKEC 180

  Fly   173 ---EPGTEWERIAKLCDFNPKVNKAGKDVSRMRSIYLHLKQNPI 213
               .||||||::|:|||||||.::..||||||||:.:.|||.|:
Zfish   181 EDDSPGTEWEKVARLCDFNPKTSRQTKDVSRMRSVLISLKQTPL 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ClcNP_001163480.1 Clathrin_lg_ch 6..212 CDD:279433 85/232 (37%)
cltbXP_005168279.1 Clathrin_lg_ch 1..223 CDD:279433 88/236 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590673
Domainoid 1 1.000 129 1.000 Domainoid score I5216
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4611
OMA 1 1.010 - - QHG46883
OrthoDB 1 1.010 - - D1577821at2759
OrthoFinder 1 1.000 - - FOG0002725
OrthoInspector 1 1.000 - - otm25180
orthoMCL 1 0.900 - - OOG6_103026
Panther 1 1.100 - - LDO PTHR10639
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3012
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.