DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and pkdc

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:295 Identity:64/295 - (21%)
Similarity:107/295 - (36%) Gaps:69/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 NAYGQVLRVSWPTIVDAATVVVK--MAPRNEARR-------SHMHVVDYYAREVFMYQKVFPVFR 91
            :.||:::||.... .|..:||||  |.|:|:...       ||...|..|..|.:.||..     
Zfish    29 SGYGEIIRVHLEG-CDRPSVVVKHVMFPQNQKHPGGWNTDISHQRKVRSYQVETYWYQNY----- 87

  Fly    92 ALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALAELHACS 156
                ..|.....|...|......::.::.|||..:|| |..:..:...:|..| |..:|..||  
Zfish    88 ----TTNENCRVPLCLAAKSFGEEQLIVLEDLDVAGF-PVRKTYVNDAEIKAC-LSWIANFHA-- 144

  Fly   157 FILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILKESDGDQ--VAAVQEVLQ 219
                                  ||.....|.....|.....:.|....|:..||  .||..|:..
Zfish   145 ----------------------LFLDVTPEGLWPIGTYWHLETRPEELEAMSDQKLKAAAGEIDS 187

  Fly   220 LCEN-QLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVL 283
            :..| :.|:                |.|||....|..:     |...::...:|||.......:.
Zfish   188 ILNNCRFKT----------------IVHGDAKLANFCF-----SKDGLQVASVDFQYVGGGCGMK 231

  Fly   284 DIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLK 318
            |::::|.:|.::|..::..|..:|.|::.:.:.|:
Zfish   232 DVIYFLGSCMDERECEKKAPGLLDYYFSELRKSLE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 64/295 (22%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 44/218 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589387
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D832683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.