DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG18765

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001097750.1 Gene:CG18765 / 59149 FlyBaseID:FBgn0042110 Length:393 Species:Drosophila melanogaster


Alignment Length:403 Identity:88/403 - (21%)
Similarity:153/403 - (37%) Gaps:83/403 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 LRVSWPTIV--DAATVVVKMAPRNEARRSHMHVVDY---------------YAREVFMYQKVFPV 89
            ||..|.|.:  .|..|.:::...:..:|...:::..               ::.|..|::.|.|.
  Fly    41 LRWKWETQLAEPALCVHIQVLVADNKKRQVSYLIKSPETVPVGLKLPRTGDFSTERHMFEVVLPA 105

  Fly    90 FRAL--SPDRNTFTVAPALQANDLKAP---DEFLIFEDLS-ESGFRPNSRCIMPTYDIVVCSLKA 148
            ...|  :.||......|.:||. ||:.   .::::.:..| .:|.:..|...|...      |..
  Fly   106 LEELYQNSDRIVHFGPPVIQAK-LKSSHIYGDYILNKGYSVANGLKGLSVTAMEGV------LSK 163

  Fly   149 LAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILKESDGDQVAA 213
            ||..||.:.......|.:.::|.:..|     .|..:|.|.|.......:....|:.:|..|.  
  Fly   164 LAAYHAGTAAYIAKTPGKIRELPKLRE-----NSKSDEETAELKSLYQLRFHESLRSNDARQY-- 221

  Fly   214 VQEVLQLCENQLKSLALYCVDG----KAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAKLID-F 273
                    |:::||...|...|    .::....||.:|..|.||:|.:.:...:  |:..|.. |
  Fly   222 --------EDKVKSFQKYVKSGTEILDSKTSFNVILNGSCWPNNLLLQVDAFGN--VKDTLFSGF 276

  Fly   274 QMSRYAPPVLDIVHYLF-ACTEKRLRDEHFPDFMDAYYNTMDQKLKSCN-LSLEGIYPRSVFNRQ 336
            ..::|.|.|.|:...|. |..||..|   |..::..|:   ||.:::.| |...|..| |:.:.|
  Fly   277 HTAQYGPAVYDLFSSLLTAPAEKSSR---FDGYVKFYH---DQLIENLNLLKFLGKKP-SLTDLQ 334

  Fly   337 LQ--QYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEEYEMLNARTL 399
            |.  :||.:........||..:|:...    :.:.|..::       |.:.|.|.|       .|
  Fly   335 LDLLKYGHWAFETATEILPIVLSDFGN----NDIEELFRN-------PVFGEQIRE-------LL 381

  Fly   400 PIFKRRITGIVED 412
            |..:.|  |..|:
  Fly   382 PWMENR--GYFEE 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 66/307 (21%)
CG18765NP_001097750.1 PKc_like 56..323 CDD:304357 63/296 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.