DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG10553

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_651383.1 Gene:CG10553 / 43064 FlyBaseID:FBgn0039324 Length:414 Species:Drosophila melanogaster


Alignment Length:365 Identity:86/365 - (23%)
Similarity:142/365 - (38%) Gaps:60/365 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AGV--GENAYGQVLRVSWPTIVDAAT-----VVVKMAPRNEARRSHMHVVDYYAREVFMYQKVFP 88
            |||  |||....:||:......:..|     .::|...::|..|..:...|.:..|..||.:|.|
  Fly    47 AGVAAGENYATVMLRIELDVEKEDNTQTTKAFMLKTPHQSEQYRKVIEKTDIFDVERGMYVEVVP 111

  Fly    89 VFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALAELH 153
            ....|..|.. ..|....:..|::|.|.:::.|||...||....|..........|.||..|:.|
  Fly   112 ELEQLYRDVG-LEVKFGAELYDIEASDYYVLLEDLRPRGFGNIDRLEGMDQAHTECVLKKFAQWH 175

  Fly   154 ACSFILQQT-DPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILKESDGDQVAAVQEV 217
            |.|.:..:| .|.|.|....|:..:.:..:.|.           |..::.|     |.|      
  Fly   176 AASAVRVETKGPYQEKYTKGFLRNEEIVDAFIN-----------RSIKVFL-----DNV------ 218

  Fly   218 LQLC---ENQLKSLALYCVDGKA---------QAPHAVIC--HGDFWNNNILYRHEPNSDQPVEA 268
             .||   |..|..|.:  |.||.         .:|...|.  |||.|.|||:.::....:.. :.
  Fly   219 -HLCKGYETYLNDLRI--VSGKTFEIVESLNNPSPDEFIALNHGDGWANNIMSQYNTKGEIQ-DT 279

  Fly   269 KLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSV- 332
            ..:|.|:.::.....|:.::|.:.|...::...|..|:..|::.:.:.||     |.| |.::: 
  Fly   280 YFVDLQVPKWGSVTQDLYYFLLSSTSLDIKTSKFDYFIWFYHSELVKHLK-----LLG-YSKTLP 338

  Fly   333 ----FNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTV 368
                .|..|.:|..:..|..|..|.:.:.:..:..|.|.|
  Fly   339 TLRRINDALNKYSGWSFICTATILAYVLLDPVDGADFDKV 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 71/306 (23%)
CG10553NP_651383.1 EcKinase 52..333 CDD:281023 73/313 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.