DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG10559

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_651382.2 Gene:CG10559 / 43063 FlyBaseID:FBgn0039323 Length:415 Species:Drosophila melanogaster


Alignment Length:409 Identity:100/409 - (24%)
Similarity:182/409 - (44%) Gaps:66/409 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QPMAGV--GENAYGQVLRVSWPTIVDAATV----VVKMAP------RNEARRSHMHVVDYYAREV 80
            :|.||:  |||....:||:.....:...|:    .:...|      |...|:::|..|:   |:|
  Fly    38 KPEAGLKPGENYSTIMLRLKLEVELQDHTIENVSYMLKTPYDFEMYREILRKNNMFAVE---RDV 99

  Fly    81 FMYQKVFPVFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIV--V 143
            |:  :|.|....:..|... .|....:|.::.|||::::.:||...|||...|  :...|:|  .
  Fly   100 FI--QVIPELEQMYKDVGV-EVKFGAKAYEIDAPDDYVLLQDLGPLGFRNVDR--LEGLDMVHTK 159

  Fly   144 CSLKALAELHACS---FILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILKE 205
            |.||.:|:.||.|   ..|:...|..:.|.   ...|.:..| ||:|....||..|:  .:.|.|
  Fly   160 CVLKKMAQWHAVSATRIHLKGPYPQNYLQP---TYADTMKES-IEQVAETLGKYFLK--CLPLYE 218

  Fly   206 SDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAKL 270
            ...:..|||.::    :.::..| :|.::.........:.|||.|.:||::::|..|.:|:|...
  Fly   219 GYEEYSAAVHKM----QPKIVDL-MYAMNTPDPQDFNALNHGDCWTSNIMFKYEDESPEPIETYF 278

  Fly   271 IDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRS---- 331
            :|.|:.:......|::::|...|:..::...|..|:..|::.:.:.|:..|      ||.:    
  Fly   279 VDLQLPKVTSVAYDLIYFLLGSTKFEIQLSQFDYFIKYYHDHLVEHLRMLN------YPEAKTPT 337

  Fly   332 --VFNRQLQQYGVYGLIMGAFSL--PFFISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEEYE 392
              ..:.||.:||..|..: ||.|  |..:....:....|.|:|     :.:.|..|    :..|.
  Fly   338 LGFLHTQLLKYGRVGYHI-AFILCPPVLLDRTEDANLTDFVTE-----TDNGDGLK----LAMYS 392

  Fly   393 MLNARTLPIFKRRITGIVE 411
              |||    :|:.::.|::
  Fly   393 --NAR----YKKHVSAILK 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 74/301 (25%)
CG10559NP_651382.2 EcKinase 45..330 CDD:281023 75/309 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459852
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26930
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.