DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31370

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:409 Identity:82/409 - (20%)
Similarity:166/409 - (40%) Gaps:79/409 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PMAGVGENAYGQVLRVSWPTIVD----AATVVVKMAPRNEARRSHMHVVDYYA------REVFMY 83
            |.:..|:|....::|.....|..    :.::::|.            |::.:|      .|:.||
  Fly    43 PGSAKGDNYASVIIRARVEYITQKGFFSKSLIIKT------------VLEMFAGSALFKTEIGMY 95

  Fly    84 QKVFPVF-RALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLK 147
            :||.|.| |.|..:.:|..:........|: |.:.:|||||.|..:......:: |:..:..:..
  Fly    96 RKVLPEFARILRENNDTSRLYAECIYYSLE-PSQVMIFEDLGEMDYAMVRDRVL-THGEICGAYS 158

  Fly   148 ALAELHACSFILQQTDPLQFKQLVEFVE--KDNLFTSDIEEVTIEFGKAQLRKARIILKESDGDQ 210
            .||:.||.|..:....|       |||:  ||.:...||..::...|..:             |.
  Fly   159 KLAKFHALSMKIINERP-------EFVKEFKDGICLVDIPYMSSGMGPFK-------------DF 203

  Fly   211 VAAVQEVLQLCENQLKSLALYCVD----------GKAQAPHAVICHGDFWNNNILYRHEPNSDQP 265
            :..:.| |...:...:.:.::.:|          ...|..:.|:||||:...||:.:|...|...
  Fly   204 LGRIPE-LDRYKTHFEKIEVHFIDRLRDIMKEYQTNPQPGYYVLCHGDYHTRNIMVKHNKESGGF 267

  Fly   266 VEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYP- 329
            .:..|:|:|....||...|:::.::....:..|.......::.|::.:.:.|:  .:..:|..| 
  Fly   268 EDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRIGELETLLNYYFSVLRETLR--KIGYQGKLPD 330

  Fly   330 RSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEEYEML 394
            ...|.:::.:...|..:..:..||.            :|..::::.:....:.|.::.|||.:.:
  Fly   331 PPAFWKEMYRLKDYEFLFLSTYLPM------------SVGLSLETATNEETDDKLQDFIEECKSI 383

  Fly   395 NARTLPIFKRRITGIVEDL 413
            .||    |:|  :|..|:|
  Fly   384 LAR----FER--SGYFENL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 63/309 (20%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 63/313 (20%)
APH <202..320 CDD:279908 22/118 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459918
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.