DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31097

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733093.2 Gene:CG31097 / 43058 FlyBaseID:FBgn0051097 Length:420 Species:Drosophila melanogaster


Alignment Length:299 Identity:71/299 - (23%)
Similarity:118/299 - (39%) Gaps:48/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GENAYGQVLRVSWPTIV-DAA----TVVVKMAPRNEARRSHMHVVDYYAREVFMYQKVFPVFRAL 93
            |.|....:|||....:: |.:    :.|||....::.....::.:.|:.:|..||....|.|..:
  Fly    47 GGNFASVMLRVYLDIVMKDGSQKRKSYVVKTMLESDKGGKAVNEMRYFHKEQQMYSTYLPQFEKI 111

  Fly    94 SPDRNTFTVA--------PALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALA 150
                  :.||        ..|:..::.. :.:.||||||...|....|......:.:..||:.||
  Fly   112 ------YRVAGHPVQLMPKCLEIGEIDG-NIYFIFEDLSTRNFVAADRTKGVNMEHMRLSLRKLA 169

  Fly   151 ELHACSFILQQT-DPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILKESDGDQVAAV 214
            ||||.|.|.::. .|........|..||.     ||.....|             |....:..|.
  Fly   170 ELHAASVIYKERYGPYHADFDNGFARKDK-----IEHSVRRF-------------EVKAPEYKAA 216

  Fly   215 QEVLQLCENQLKSL------ALYCVDGKAQAPH--AVICHGDFWNNNILYRHEPNSDQPVEAKLI 271
            .:...:.|..||:.      ...|::.....|.  .|:.||||..:|||:::..|. .|.||.::
  Fly   217 MKTWGIDECYLKNFPTTEQYGKLCLESLNVDPQDFNVLTHGDFSPSNILFKYNENG-APSEALIL 280

  Fly   272 DFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYY 310
            |||:.::|.|..|::..:.....|....:.|.:.:..|:
  Fly   281 DFQICKWASPTQDLLMLIILSARKDSSYKEFDNIVRIYW 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 71/299 (24%)
CG31097NP_733093.2 EcKinase 46..331 CDD:281023 71/299 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459840
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.