DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31098

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:435 Identity:99/435 - (22%)
Similarity:194/435 - (44%) Gaps:73/435 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELSYAVTRVLLELYQRHGIPMVSQPMAGVGENAYG---QVLRVSWPTIVDAA-----TVVVKMAP 61
            |...|||.::::             .|.||:.|.|   ::.|.|:......|     :|:||..|
  Fly    29 EEQLAVTELIVK-------------SAQVGDQAAGFASEMHRASFNLQRGTAPKGKFSVIVKDHP 80

  Fly    62 RNE----ARRSHMHVVDYYAREVFMYQKVFPVFRALSPDRNTFT-VAPALQANDLKAPDEFLIFE 121
            :.:    |.||.:     :.||:..|::|.|..:||.......| :||..... .::|:.|||.|
  Fly    81 KGQTGAVAHRSKL-----FKREILAYKEVLPRIQALLQSIGDQTKIAPTCYYT-TESPEPFLILE 139

  Fly   122 DLSESGFRPNSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEE 186
            |:..|||....|..:...|.|:.:::.:|:|||||.::.|..|    :::||.::..:..:....
  Fly   140 DMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALIAQDSP----EVLEFFDEAPISRNPDRR 200

  Fly   187 VTIEFGKAQLRKARIILKESDGDQVA-------AVQEVLQLCENQL-KSLALYCVDGKAQAPHAV 243
            ..:.|....:|..        .::||       ..:::..|.||.| ::|.::...||   ...|
  Fly   201 DFLTFFPVNIRCV--------AEEVAHWKGYEEITEKMFNLAENVLQRALTMFESTGK---DFRV 254

  Fly   244 ICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDA 308
            ....|.|.||:|:.....:.:|.:...:|||::....|.:|:.::|:....:.:|..|:...:..
  Fly   255 FNLTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENVRKVHYKYIVRE 319

  Fly   309 YYNTMDQKLKSCNLSLEGIYPR-SVFNRQLQQYGVYGLIMGAFSLPFFI----SNANEVIDIDTV 368
            |...:.|.|:  .|:.:|..|. ...:.:|.:..:.|:| ||..|...|    :....:.|:::.
  Fly   320 YQRVLQQTLE--KLNYQGHIPTLKEIHIELIKTSLMGVI-GATCLTPLIFREGAGFENLEDLNSR 381

  Fly   369 SEAIQSISTSS-DEPKYKELIEEYEMLNARTLPIFKRRITGIVED 412
            :|:.......: :.|||:..::       ||:..|:  ::|.:::
  Fly   382 TESGDRFRRENVENPKYRAFLQ-------RTIKEFE--LSGFLDE 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 74/307 (24%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 73/305 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.