DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31104

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733090.1 Gene:CG31104 / 43054 FlyBaseID:FBgn0051104 Length:420 Species:Drosophila melanogaster


Alignment Length:398 Identity:88/398 - (22%)
Similarity:161/398 - (40%) Gaps:61/398 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PMAGVGENAYGQVLRVSWPTIVDAAT--------VVVKMAPRNEARRSHM----HVVDYYAREVF 81
            |....|:: |..|:   :.|.|:..|        :::|..|..|..:..|    |:   :..|:.
  Fly    46 PATAQGDH-YASVM---FRTKVEYTTPKGKFFKPLIIKTMPEQEGHKKDMLSESHL---FETEIG 103

  Fly    82 MYQKVFPVFRALSPDR--NTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVC 144
            ||....|.|..:..:.  ||....|.:. :.|| |.:.:|||||...|:.. .|...|:...:..
  Fly   104 MYCHALPEFERILREAGDNTKLFVPCIY-HSLK-PRQVMIFEDLVPQGYTV-IRDSPPSLGDLKL 165

  Fly   145 SLKALAELHACSFILQQTDPLQFKQ----LVEF--VEKDNLFTSDIEEVTIEFGK-AQLRKARII 202
            :...||:.||.|..:....|...|:    |.|.  ::.|...|:.:........| .:|||.:..
  Fly   166 AFDKLAKWHAVSMKVINEQPYFLKEFQYGLFEMPTIDTDPFITTGMTNFIEMLDKMPELRKYKHH 230

  Fly   203 LKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVE 267
            .::       .....:|..|.::.....|    :....:.|:|||||...|:::||........:
  Fly   231 FEK-------IKDNYMQRLEVEMHEYHKY----RRNDRYYVLCHGDFHLRNMMFRHNKELGAYDD 284

  Fly   268 AKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYP--R 330
            ..|:|||:|...|..:|:.:.::...|...|.|...:.::.|::.:...|:  .:..:|..|  |
  Fly   285 VMLVDFQLSNLCPITVDLTYSVYMLMEPEQRWEMGENLINEYFSVLVATLR--KIGYKGDMPTQR 347

  Fly   331 SVFNRQLQQYGVYGLIMGAFSLPFFIS-NANEVIDIDTVSEAIQSISTSSD--------EPKYKE 386
            .:: .|:|....|...:.:..||..:. .:|::    .:.||:|.......        :..|| 
  Fly   348 ELW-EQIQNNKYYDFFLISTFLPIMVGVKSNDL----KMHEALQDSQARLKSYFLDDYVQDVYK- 406

  Fly   387 LIEEYEML 394
            |:.:||.|
  Fly   407 LLTKYEQL 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 69/307 (22%)
CG31104NP_733090.1 EcKinase 50..339 CDD:281023 69/311 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459908
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.