DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG11892

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_651372.1 Gene:CG11892 / 43053 FlyBaseID:FBgn0039313 Length:439 Species:Drosophila melanogaster


Alignment Length:429 Identity:100/429 - (23%)
Similarity:177/429 - (41%) Gaps:81/429 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PMAGVGENAYGQVLRVSWP-TIVDAAT-----VVVKMAPRNEARRSHMHVVDYYAREVFMYQKVF 87
            |..|.|||..|.:.||... |..|.::     :|......||..::.|...|.:.||:.:|::|.
  Fly    64 PALGKGENYGGVLTRVKAQFTRSDGSSQLGHYIVKSTFEGNEFAQNAMKPYDIFNREMIIYEQVL 128

  Fly    88 P----VFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKA 148
            |    :.|.:......|....|:..:     :..||||||:..||....|.:.....:....|:.
  Fly   129 PKQKALLREIGDAEQIFAETMAVDID-----NSALIFEDLNARGFVMPDRLVGLDQKLARIVLRK 188

  Fly   149 LAELHACSFILQQTDPLQFKQLVEFVEKD--NLFTSDIEEVTIEFGKAQLRKARIILKESDGDQV 211
            ||::||.|.:|.:.:    ..::|..::.  |.:|.:.|...:...:|..|:    :.:..|.:.
  Fly   189 LAKMHATSAVLNERE----NHILESYDRGFFNRYTDNYEPAFVGMLQAATRR----VAQWPGYEK 245

  Fly   212 AAVQEVLQLCENQLKSLA-LYCVDGK----AQAPHA-VICHGDFWNNNILYRHEPNSDQPVEAKL 270
            .|         .:||:|. :|...||    ....|. |:.|||.|.||:|.:::..:.:|::..:
  Fly   246 YA---------EKLKALVPIYMELGKRIFDISPGHINVLAHGDLWTNNVLVKYDKQTGEPIDVVI 301

  Fly   271 IDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPR-SVFN 334
            ||||.:.:..|.||:.:::.:..|..|...|....:..|:......||  .|......|. ..|:
  Fly   302 IDFQYTAWGSPALDLFYFMNSSLEFDLHQNHQEQLIAYYFRHFADTLK--KLQYRSTIPSLHQFH 364

  Fly   335 RQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEEYEMLNARTL 399
            :||||...|.              |:..|.:..|...:::.     :..:..|:|.    |.|.:
  Fly   365 QQLQQKKFYA--------------AHTSISVFPVQRNVETA-----DADFNALMEN----NQRAM 406

  Fly   400 ---------PIFKRRITGIVEDLIKYNMTEPLFKMDSEQ 429
                     ||.:|    |:.:|:.....|.|  :|::|
  Fly   407 NFKDACYRNPIAQR----ILRELLPDFEAEGL--LDADQ 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 74/304 (24%)
CG11892NP_651372.1 EcKinase 68..353 CDD:281023 75/308 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459594
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.