DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG14314

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_650690.1 Gene:CG14314 / 42179 FlyBaseID:FBgn0038581 Length:438 Species:Drosophila melanogaster


Alignment Length:393 Identity:99/393 - (25%)
Similarity:170/393 - (43%) Gaps:65/393 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VVVKMAPRNEARRSHMHVVDYYAREVFMYQKVFP---VFRALSPDRNT--FTVAPALQANDLKAP 114
            |:.|:.|.:...|........:..||..|..:.|   .|:|...:::|  |...|...:    |.
  Fly    81 VICKVMPESVVAREAYKSDKLFRNEVQFYNTIMPELLKFQASKTNQDTPVFNAIPKCYS----AR 141

  Fly   115 DEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFKQLVEFVEKDNL 179
            .:.||.|||.|.||:.:.|....:.:.....|..:|:||..|...:...||:|..|...:.:...
  Fly   142 HDLLIMEDLRERGFQMSDRHKGLSLEETQSVLLQVAQLHGLSLAYKFEKPLEFSNLCSMISEGIF 206

  Fly   180 FTSD-------IEEVTIEFGKAQLRKARIILKESDGDQVAAVQEVLQLCE--NQLKSLALYCVDG 235
            .|::       .|.:|    |..::....:| ..|...|.|:.:..:...  .::..||      
  Fly   207 CTANTSWYRNYYERLT----KNAIQMVSEVL-PPDSKYVLAMNKFAESSSFFGRMVKLA------ 260

  Fly   236 KAQAPHAVICHGDFWNNNILYRHEPNSDQPV-EAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRD 299
            ..::|.:.|||||.|.||.||.::|.....| |..|:|||:.||:...|||.:.|:.||.|.:||
  Fly   261 STESPLSAICHGDCWVNNFLYHYDPEDPHRVLEVALLDFQLIRYSSIALDIANLLYCCTTKEMRD 325

  Fly   300 EHFPDFMDAYYNTMDQKLKS-C-NL-----SLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFIS 357
            ......:..|...:.:.|:. | ||     :|:.:  :.:|..:|:.||.:.|.:          
  Fly   326 AQLQTLLKIYTEELFRWLQMLCTNLPDHCDTLQKL--QDLFAEELKTYGRFALGL---------- 378

  Fly   358 NANEVIDIDTVSEAIQSISTSSDEP-KYKELIEEY-EMLNARTL-----PIFKRRITGIVEDLIK 415
             |.:::.|.|.|        |.|.| .|.:..:|. |.:.|.||     .:.:::::.||.|::.
  Fly   379 -ALDILPISTCS--------SEDAPDMYLDRSDELGEDVGAPTLNFPPNDLCRQKMSEIVIDMVD 434

  Fly   416 YNM 418
            .:|
  Fly   435 RDM 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 74/282 (26%)
CG14314NP_650690.1 EcKinase 56..346 CDD:281023 73/279 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I6679
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D433354at33208
OrthoFinder 1 1.000 - - FOG0002485
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.