DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG6908

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_650105.1 Gene:CG6908 / 41410 FlyBaseID:FBgn0037936 Length:449 Species:Drosophila melanogaster


Alignment Length:384 Identity:85/384 - (22%)
Similarity:155/384 - (40%) Gaps:90/384 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QPMAGVGENAYGQVLRVSWPTIVD-----AATVVVKMAPRNEARRSHMHVVDYYAREVFMYQKVF 87
            :|.||.|||....:||.::...::     :.:.:.|:.| |...|.::.....:.:|...|.:..
  Fly    76 EPTAGKGENYTTLLLRANFELELNDGSEQSISYMAKILP-NSGNRENVASWKVFYKERNTYGQYI 139

  Fly    88 PVFRALSPDR-NTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDI--VVCSLKAL 149
            |.|..:..|. ...:..|....:.::..||.::.|||.:.|||...|  ....||  ...:|:.|
  Fly   140 PEFEQMYKDAGKKISFGPRYYESQIELDDELIVLEDLGKRGFRNVDR--QNGLDIQHTEATLEKL 202

  Fly   150 AELHACS---FILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARIILKESDGDQV 211
            |:.||.|   |.|:.:.|.::.|        ||                               .
  Fly   203 AQFHAASAVRFELKGSYPEEYNQ--------NL-------------------------------C 228

  Fly   212 AAVQEVLQLCENQLK----SLALYCVD---------------------GKAQAPHAVICHGDFWN 251
            :.|..:.:|.|||||    :..||...                     .|.:....|:.|||.|.
  Fly   229 SVVDSLKELRENQLKAYIDAFPLYDASHLTNDVQAYGSQADDMFQSFAPKIEGEFRVLNHGDAWC 293

  Fly   252 NNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQK 316
            |||:|::: .:.:..|...:|.||||::.|..|:::.:.:.||..::...|...:..|:..:.:.
  Fly   294 NNIMYQYD-EAGKLAEVNFVDLQMSRFSSPAQDLLYLILSSTELDIKIAKFDYLIKFYHEKLIES 357

  Fly   317 LKSCNLSLEGIYPRSVFN-RQLQQ----YGVYGLIMGAFSLPFFISNANEVIDIDTVSE 370
            ||...      ||:.:.: |.|.|    ||.:.|.:.:..||..:.:..:..::|::.:
  Fly   358 LKLLK------YPKPLPSLRSLHQSIFIYGDWILPIVSILLPLVLIDGGDDANMDSLMD 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 71/322 (22%)
CG6908NP_650105.1 EcKinase 81..363 CDD:281023 71/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.