DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG6834

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_650104.2 Gene:CG6834 / 41409 FlyBaseID:FBgn0037935 Length:895 Species:Drosophila melanogaster


Alignment Length:408 Identity:89/408 - (21%)
Similarity:167/408 - (40%) Gaps:73/408 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GENAYGQVLRVSWPTIVDAAT-----VVVKMAPRNEARRSHMHVVDYYAREVFMYQKVFPVFRAL 93
            |:|...::|::...|.:...|     .::|:.|::..  .:...|:.:.:|:.||||..|.|..|
  Fly   530 GDNFASKLLKIDIETQLKDHTSKTFSYILKVQPKSTP--DNFTDVNMFPKEMEMYQKYVPAFEQL 592

  Fly    94 SPDRN---TFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALAELHAC 155
            ..|..   |||....:....:|  :|:|:.|:|...||:...|......:....|||.||:.||.
  Fly   593 YKDAGLTVTFTANSFVLNKAVK--EEYLLMENLQTKGFKMADRMKGLNMEHTKSSLKKLAQWHAA 655

  Fly   156 SFILQQTDPLQFKQLVE----------FVEK-----DNLFTSDIEEV-----TIEFGKAQLRKAR 200
            |        :::|:|..          ::|:     .|:|.|..|..     |.|.....|.|..
  Fly   656 S--------IKYKELNGAYPPLYNDGIYIEQTRDVFHNMFASAKEAYIRIFGTFEGADEYLPKLE 712

  Fly   201 IILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQP 265
            .|: ::..|||....::.:...|                   |:.|||.|.|||:::::... :.
  Fly   713 WII-DNHVDQVLEDAKINEQAFN-------------------VLNHGDAWINNIMFQYDAEG-RL 756

  Fly   266 VEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPR 330
            .|..|:|.|.::|..|..|:.::|.:..|..::.:.|.:.:..|:..:.:..|.  |...|..| 
  Fly   757 KETYLLDHQNAKYGNPAQDLYYFLISSAELDIKVDEFDNLIRFYHENLVEHTKL--LKYNGFVP- 818

  Fly   331 SVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDEPKYKELI--EEYEM 393
                 .|.:.....:...||::...||.....:..:..:..:..:.|...|....:|:  |.|:.
  Fly   819 -----SLSELHAILIEHPAFAVGTVISTLTVCLTDEGFNPELFFVETPESEAFRTKLLGNERYKA 878

  Fly   394 LNARTLPIFKRRITGIVE 411
            ...:.:|...||  |:::
  Fly   879 HVEKIMPWLNRR--GLLD 894

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 72/314 (23%)
CG6834NP_650104.2 EcKinase 95..387 CDD:281023
EcKinase 529..813 CDD:281023 73/317 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459862
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.