DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG6830

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_650103.1 Gene:CG6830 / 41408 FlyBaseID:FBgn0037934 Length:891 Species:Drosophila melanogaster


Alignment Length:416 Identity:95/416 - (22%)
Similarity:176/416 - (42%) Gaps:85/416 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GENAYGQVLRVS-----WPTIVDAATVVVKMAPRNEARRSHMHVVDY--YAREVFMYQKVFPVFR 91
            |:|...::|:|.     ....|...:.::|:...|:|    ::..|:  :.:|:.:|....|.|.
  Fly   517 GDNFASKLLKVEIEAQLKDNSVKTFSYILKVHSDNDA----INFSDFNLFPKEIEVYSTYVPAFE 577

  Fly    92 ALSPDRN---TFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALAELH 153
            ....|..   ||:......:.|:.  .|:|:.|:|..|||:...|.|....:...|:||.||:.|
  Fly   578 RFYKDVGLPVTFSPKSFRLSKDVS--KEYLLLENLQPSGFKMVDRMIGMDLEHSKCTLKKLAQWH 640

  Fly   154 ACS-----------------FILQQTDPLQFKQLVEFVEKDNLFTSDIEEVTIEFGKAQLRKARI 201
            |.|                 ...:||.|: ||.:  ||   |...|.||||:             
  Fly   641 AASLKYKELNGPYSPKYNNGIFTEQTAPI-FKGM--FV---NTKKSFIEEVS------------- 686

  Fly   202 ILKESDG--DQVAAVQEVLQLCENQLKSLALYCVDGKA-QAPHAVICHGDFWNNNILYRHEPNSD 263
               :.||  :.:..:.|:|....:::..      |.|. :....|:.|||.|.|||::::|  ||
  Fly   687 ---KFDGVDEYLHKMPEILDTYVDRILE------DAKINEQAFNVLNHGDAWINNIMFQYE--SD 740

  Fly   264 QPV-EAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGI 327
            ..| |..|:|.|:::|..|..|:.:::.:.|:..::.:.|...:..|:..|.:..|..|.:  |.
  Fly   741 GRVKETLLLDHQVTKYGNPAQDLYYFIMSSTQLDIKVDQFDYLIRWYHQNMKEHAKLLNYN--GF 803

  Fly   328 YPR-SVFNRQLQQYGVY--GLIMGAFSLPFFISNANEVIDIDTVSEAIQSISTSSDEPKYKELI- 388
            .|. ...:..|.|:.::  |.::...|:..     |:..| |..:::.  :....:....:|.: 
  Fly   804 IPSLKELHAILIQHPIFAAGTVLTTLSMCL-----NKTTD-DFTTDSF--LGNEENGKSLREAMF 860

  Fly   389 --EEYEMLNARTLPIFKRRITGIVED 412
              |.|.....|.:|...||  |::::
  Fly   861 SNERYRANIERVMPWINRR--GLLDN 884

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 77/317 (24%)
CG6830NP_650103.1 EcKinase 80..372 CDD:281023
EcKinase 516..800 CDD:281023 77/318 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459864
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.