DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG9498

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_609015.2 Gene:CG9498 / 33885 FlyBaseID:FBgn0031801 Length:424 Species:Drosophila melanogaster


Alignment Length:379 Identity:88/379 - (23%)
Similarity:159/379 - (41%) Gaps:44/379 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GENAYGQVLRVS-----W-----PTIVDAATVVVKMAPRNEARRSHMHVVDYYAREVFMYQKVFP 88
            |:|....:.||.     |     ..:.:..:::||..|..||.: .:..|..:.:|...|..|.|
  Fly    48 GDNYCSAIYRVGVSFARWADGGESPVTEQLSLIVKTIPITEATQ-FLEDVCVFIKEKQTYTDVLP 111

  Fly    89 VFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALAELH 153
            ....||.. :||   .|...:.:|.|.:.::|.||:..||:..||.....::.....|:.|.:.|
  Fly   112 RLDILSRG-DTF---GAKYYHSVKTPVQTIVFSDLTVEGFKVASREKGLDWNHASLILQQLGKFH 172

  Fly   154 ACSFILQQTDPLQFKQLVE-FVEKDNLFTSD-IEEVTIEFGKAQLRKARIILKESDGDQVAAVQE 216
            |.|.:|.:.||...||... .:.:|.|..|| .|::...|.|..::.:.         ..|..::
  Fly   173 ATSMVLAKKDPAIVKQYTRGMLSEDILMKSDTFEQMFGGFLKGLIKSSA---------SWAGYEK 228

  Fly   217 VLQLCENQLKSLALYCVDGKAQAP-----HAVICHGDFWNNNILYRHEPNS--DQPVEAKLIDFQ 274
            :.:..:..:.:....|.|  |..|     :.|:.|||.|.||.:|.::..|  |.|..|..:|||
  Fly   229 ISKHLQRLMDNFRNVCAD--APRPRKGDRYVVLNHGDLWTNNFMYGYDNASQPDVPTRAIFVDFQ 291

  Fly   275 MSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSVFN-RQLQ 338
            :|.|..|..|:..:|....:.:|..|...:.:..||.:....|:.........|....:. |..:
  Fly   292 LSFYGSPACDLNFFLNTSIKLQLLQERREELIKVYYASFKDALEYARFEDIPSYEDLQYELRSRE 356

  Fly   339 QYGVYGL--IMGAFSLPFFISNANEVIDIDTVS------EAIQSISTSSDEPKY 384
            .||::|:  .:...::|..::..|.:.::...:      :||.|....:|..|:
  Fly   357 TYGLFGMFAFLPMITMPKELAQDNSIENMQDEAFKQRKMDAIFSQKFLNDHQKW 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 76/305 (25%)
CG9498NP_609015.2 EcKinase 47..339 CDD:281023 76/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459319
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.