DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG33509

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:380 Identity:86/380 - (22%)
Similarity:139/380 - (36%) Gaps:89/380 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 DYYA-------------REVFMYQKVFPVFRALSPDRNTF--------TVAPALQA--------N 109
            ||||             ||:.::.|..|...|.....:.|        |:...|||        |
  Fly    40 DYYALTLRYCHEEEEIIREIELFVKAMPQQSAELSKESIFQKESWLYDTLIKKLQALSNVKWSPN 104

  Fly   110 DLKAPDEFLIFEDLSESGFRP------NSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFK 168
            .:.:..:.::.|::...||..      |...:.|.       :|::|..|:.|.:.:.    |.|
  Fly   105 CVYSRKDLMVLENIKLKGFTSAGSAELNEVFVKPL-------IKSIAAFHSASLVYEH----QTK 158

  Fly   169 QLVEFVEKDNL--FTSDIEEVTIEFG-KAQLRKARIILKESD-------GDQVAAVQEVLQLCEN 223
            ..:.....|||  .|.|.|......| .|.|...|.:.|...       ||::..:.|       
  Fly   159 TNIGHTYGDNLLEITVDSEIAWFTTGLSAVLAVVRSLAKYQGNREQSFIGDKLMGIME------- 216

  Fly   224 QLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHY 288
                 .:|.....::....|:||.|.|..||.:  .|.:..|  |.|||||..|||||..|:...
  Fly   217 -----TIYEQAAPSKKYRNVLCHRDIWAGNIFF--PPENSGP--ALLIDFQTCRYAPPASDLNFC 272

  Fly   289 LFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLP 353
            |:.......|.:.....:|.|:..:.|.|....|. |.:..:|......:::.::|::..|.:..
  Fly   273 LYMNLSSSKRKQMEKQGIDLYHTYLLQNLSDLGLE-ELVISKSELLESYEEFRLFGVVYRAVAAT 336

  Fly   354 F------FISNANEVIDIDTVSEAIQSISTSSDEPKYKELIEE-----YEMLNAR 397
            .      ||:|..:.:|...|     .:|.....|::...:||     .||..||
  Fly   337 VVKVPTDFITNDFKYVDRSKV-----ILSYMKTNPEFATYMEECCVDVMEMALAR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 68/291 (23%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 62/268 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.