DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG33510

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:300 Identity:67/300 - (22%)
Similarity:120/300 - (40%) Gaps:74/300 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 NEARRSHMHVVD---YYAR-EVFMYQKVFPVFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDL 123
            ||.::...||..   |:.| ::|:.|.|..:.....|....|                      |
  Fly   112 NELKKFSKHVWSAKCYFTRKDLFVMQNVEDMGYVALPPGTRF----------------------L 154

  Fly   124 SESGFRPNSRCIMPTYDIVVCSLKALAELHACSFILQ----QTDPLQFKQLVEFVEKDNLFTSDI 184
            :|:...|              .||:||.|||.|...:    :|..::|::.::.|..|    .::
  Fly   155 NENQMGP--------------ILKSLATLHASSIAYEKQQGKTIGVEFRKWLKEVSVD----PEV 201

  Fly   185 EEVTIEFGKAQLRKARI---ILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICH 246
            |..|... :|.|..|.|   :|...:..:..| || |..|.::     :||:...:.....|..|
  Fly   202 EWYTTGL-RAVLAVAAIHPDVLDNPEAQEYIA-QE-LPRCLDK-----VYCMVNPSPVHRNVFVH 258

  Fly   247 GDFWNNNILYRHE-PNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYY 310
            .|.||.|:.|..| |:.::.:   |:|||:.||:||.:|.....:...|...|.:.....::.||
  Fly   259 RDAWNANVFYHKEKPHEERSI---LVDFQLCRYSPPAMDFHLVTYLNLEPFSRKKMIGSLIETYY 320

  Fly   311 NTMDQKLKSCNLSLEGIYP------RSVFNRQLQQYGVYG 344
            :.:.::.:..     |:.|      :..|.:.|..:.::|
  Fly   321 DALAEEFREM-----GVNPYQEQLSKQEFEQSLNDFSLFG 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 62/269 (23%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 56/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459900
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.