DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG33511

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:393 Identity:84/393 - (21%)
Similarity:164/393 - (41%) Gaps:83/393 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VKMAPR-NEARRSHMHVVDYYAREVFMYQKVFPVFRALSPDRNTFTVAPALQANDLKAPDEFLIF 120
            :|..|| ||.:|........:.:|..:|.::.|..:..:..:        |......:.::.|:.
  Fly    68 IKSLPRKNEPQREECERKGVFQKESALYSQILPKIQKYATKK--------LYPKCYYSRNDILVL 124

  Fly   121 EDLSES--GFRPNSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFKQLVEFVEKDNL-FTS 182
            |||::.  ..|.|....:..|.||   |:.|:||||.|              :.:.||:|: ...
  Fly   125 EDLTQDYRHLRANEYYTLDHYKIV---LEHLSELHAAS--------------IAWEEKENVKIYE 172

  Fly   183 DIEEVTIEFGKAQLRKARIILKESDGDQVAAVQEVLQL-----------CENQLKSLALYCVDGK 236
            ..:.|.||          :.|..::...:..::.::.|           .:|.::. .||.:..|
  Fly   173 SYKNVLIE----------LHLDSNNSWYITGLKAIVFLAARNPHFQTMKAQNFIQD-KLYNLLTK 226

  Fly   237 AQ---AP----HAVICHGDFWNNNILYR-HEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACT 293
            |:   ||    ..|:||.|.|::||:|. ::.:|..|....::|||:::|..|.||::..|:...
  Fly   227 AEELVAPSKTIRNVLCHRDTWDHNIVYYFNKESSVLPNACCIVDFQLTQYCSPTLDVLFLLYIVA 291

  Fly   294 EKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISN 358
            ...:|...:.:.::.||..:...|....|. :.:...:.|.::.|:..:..|::.|.:.|     
  Fly   292 SAEVRRAIYDECLEHYYKNLQHHLDRLGLD-KNLITENNFRKECQRTRLAALVIWALTEP----- 350

  Fly   359 ANEVIDIDTVSEAIQSIST--SSDEPK---YKELIEEYEMLNARTL---PIFKRRITGIVEDLIK 415
                     .::...|||.  .|:||:   |....:..|:| .|.:   |.::..|...:.:|:.
  Fly   351 ---------QTKMSPSISNRLRSEEPEKFDYYLNCDRSELL-LRVIEIQPGYEETIMTPIRELVD 405

  Fly   416 YNM 418
            |.|
  Fly   406 YLM 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 63/286 (22%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 63/286 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459902
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.