DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG5126

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_608584.1 Gene:CG5126 / 33306 FlyBaseID:FBgn0031320 Length:455 Species:Drosophila melanogaster


Alignment Length:469 Identity:84/469 - (17%)
Similarity:165/469 - (35%) Gaps:108/469 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ELSYAVTRVLLELYQRHGIPMVSQPMAGV----GENAYGQVLRVSWPTIVDA-----ATVVVKMA 60
            :|.|....::.::::..| |..|.....|    |.:.:...|......:|.|     ..|:||..
  Fly     7 QLDYIERHLVYDIFKNFG-PSASLESHSVECSNGLDGFMSALYTVTLDVVIAERKRTEVVLVKFM 70

  Fly    61 PRNEARRSHMHVVDYYAREVFMYQKVFPVFRALSPDRNTFTVAPALQANDLKAP----------- 114
            ...|..|...:....::.|:|.|.::.|.:..:            |:.:.|::.           
  Fly    71 KGTEEFRESSNSYIQFSNEIFAYAEILPAYENV------------LRTSHLESEVVKNWVPCCYF 123

  Fly   115 -------------DEFLIFEDLSESGFRPNSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQ 166
                         :..|..:.|...|::...|..: ..|.:...:..:...||..:..:...|..
  Fly   124 ARFGHVEGLGNGRESVLALKHLKGDGYQLGPRLTL-RRDQLEAMVGLVGPFHALGYATKILQPNV 187

  Fly   167 FKQL------VEFVEKDNLFTSDI-EEVTIE-FGKAQLRKARIILKESDGDQVAAVQEVLQLCEN 223
            ..:|      :.||........|: ..|..: |.:...|:...:|:.:|....||::   :|.|.
  Fly   188 HARLRAGVVDMPFVSSSGKGIFDVLYRVAFDRFYEFYDRQKEQLLQGADPGFGAAIE---RLREK 249

  Fly   224 QLKSLALYC--------VDGKAQAPHAVICHGDFWNNNILYRHEPNSDQPVEA-KLIDFQMSRYA 279
            ..|...|..        .:.:..:..|...|||:..||:|:.:  .::..|:| |.||||..|::
  Fly   250 YFKQPTLLLERIRTSSFAEDQPDSHFATFLHGDYNRNNVLFHY--GAEDKVDAIKAIDFQELRFS 312

  Fly   280 PPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTM--------------------DQKLKSCNLSL 324
            ...:|:..:::..|....|.|.:.|.:..|:.:|                    ||.|:.     
  Fly   313 TTAIDLSFFMYMNTPSEGRKEIYADLLRKYHRSMIEMLELVLRRNRNELTDDRVDQLLQE----- 372

  Fly   325 EGIYPRSVFNRQLQQYGVYGLIMGAFSLPFFISNANEVIDIDTVSEAIQ--------SISTSSDE 381
               |....||...::|..||.::....||:.:....:..::..:.|...        |:..:.||
  Fly   373 ---YSFERFNAHFKRYAFYGPMVCMHFLPWLLGTEKDCAELSRLFETDMHGPAFHQLSLDIAGDE 434

  Fly   382 PK---YKELIEEYE 392
            ..   :|.:...||
  Fly   435 ANQEIFKTVRHAYE 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 63/352 (18%)
CG5126NP_608584.1 EcKinase 41..353 CDD:281023 59/329 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.