DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31300

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:407 Identity:90/407 - (22%)
Similarity:170/407 - (41%) Gaps:86/407 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PMAGVGENAYGQVLRVSWPTIVDAAT--------VVVKMAPRNEARRSHM----HVVDYYAREVF 81
            |.:..|:: |..|:   :.|..:..|        :::|..|..:..:..|    |:   :..|:.
  Fly    48 PASAQGDH-YASVM---FRTTAECTTAKGKFSRPLIIKAMPEQDGHKKDMLSESHL---FETEIG 105

  Fly    82 MYQKVFPVFRAL---SPDRNTFTVAPALQANDLKAPDEFLIFEDLSESGF-----RPNSRCIMPT 138
            ||.:|.|.|..:   |.| :|....|.:. :.|: |.:.:|||||...|:     ||.::..:.|
  Fly   106 MYCQVLPEFERILRESGD-DTKLFVPCIY-HSLE-PRKVMIFEDLVPQGYYVIRDRPVAQEELKT 167

  Fly   139 YDIVVCSLKALAELHACS--FILQQTDPL-QFKQ-LVEF--VEKDNLFTSDIEEVTIEFGK-AQL 196
                  :...||:.||.|  :|.:|.|.| :||. |.|.  |:.|...|:.::.......: .:|
  Fly   168 ------AFAKLAKWHAISMKYIKEQPDFLKEFKYGLFEMPTVKTDPFITTGMQSFIEMLDRLPEL 226

  Fly   197 RKARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDGKAQAPHAVICHGDFWNNNILYRHEPN 261
            ||.:...::.....:..:|.|::......||.|.|           |:|||||...|:::::...
  Fly   227 RKYKPHFEKIKDKYMQRLQAVMKEYHENRKSDAFY-----------VLCHGDFHLRNMMFKNNKG 280

  Fly   262 SDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRLRDEHFPDFMDAYYNTMDQKLKSCNLSLEG 326
            :....:..|:|||:|...|..:|:.:.::...|...|.|...|.::.|...:...|||..     
  Fly   281 TGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINHYLTVLVATLKSIG----- 340

  Fly   327 IYPRSVFNR-----QLQQYGVYGLIMGAFSLPFFIS------NANEVID----------IDTVSE 370
             ||..:..:     ::.:...|...:.:..||..::      ..|::|.          :||..:
  Fly   341 -YPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSKSFKVNDLIQDPETRQKTYFLDTYVK 404

  Fly   371 AIQSISTSSDEPKYKEL 387
            .:..:.     ||:::|
  Fly   405 DVSKLL-----PKFEQL 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 77/313 (25%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 77/321 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459906
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.