DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13813 and CG31099

DIOPT Version :9

Sequence 1:NP_649195.1 Gene:CG13813 / 40218 FlyBaseID:FBgn0036956 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_733099.1 Gene:CG31099 / 326117 FlyBaseID:FBgn0051099 Length:400 Species:Drosophila melanogaster


Alignment Length:371 Identity:83/371 - (22%)
Similarity:145/371 - (39%) Gaps:96/371 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 MHVVDYYAREVFMYQKVFP----VFRALSPDRNTFTVAPALQANDLKAPDEFLIFEDLS------ 124
            |:.:..:.||..:|..|.|    ::|.:.   ...:..|.....|.....::::.|||.      
  Fly    81 MNQLKMFQREHQVYHNVLPKLEEIYREVG---KKVSFGPRAFRLDYSIGVQYVLLEDLKAKSYKN 142

  Fly   125 ---ESGFRPNSRCIMPTYDIVVCSLKALAELHACSFILQQTDPLQFKQLVEFVEKDNLFTSDIEE 186
               ::||  |..|:...       ||.||:.||.|.:..:........||     :.::|...|.
  Fly   143 VERQAGF--NKLCLKQV-------LKKLAQFHAASAVCVEKHGAFSNLLV-----NGVYTKANES 193

  Fly   187 VTIEFGK-----AQLRK--------ARIILKESDGDQVAAVQEVLQLCENQLKSLALYCVDG--K 236
            |..|...     :|||:        .|::.||.|                        .|||  |
  Fly   194 VLQELNDPEIFLSQLRRWRLGDHFHKRLVEKEKD------------------------LVDGLLK 234

  Fly   237 AQAPHA----VICHGDFWNNNILYRHEPNSDQPVEAKLIDFQMSRYAPPVLDIVHYLFACTEKRL 297
            ..:|.:    |:.|.|.|.||::::.: :|....:..|:|:|:.:|..|.:|:.:.:.:..||.:
  Fly   235 LHSPDSNEFNVLNHSDCWVNNVMFKFD-DSGHVEDTALLDYQLVKYGSPAIDLYYTILSSAEKDI 298

  Fly   298 RDEHFPDFMDAYYNTMDQKLKSCNLSLEGIYPRSVFNRQ-LQQYGVYGLIMGAFSLPFFISNANE 361
            :...|.:.:..|:..:...||:.|..  |..|:....|. |.:.|:...::...:||..:.|..|
  Fly   299 KLAQFDNMVQYYFYHLLDNLKALNFG--GSLPQLQHIRDALNKNGLAAYVVVTRALPITMMNQFE 361

  Fly   362 VIDIDTVSEAIQS-----ISTSSDEPKYKELI-------EEYEMLN 395
                |.|:|...|     :.||.   ||.:.|       ||..:||
  Fly   362 ----DEVNERYASKMKCAMFTSR---KYIQAIKDILPWMEERSLLN 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13813NP_649195.1 EcKinase 34..321 CDD:281023 60/282 (21%)
CG31099NP_733099.1 EcKinase 44..323 CDD:281023 60/283 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.